Property Summary

NCBI Gene PubMed Count 15
Grant Count 9
Funding $717,359.42
PubMed Score 13.28
PubTator Score 7.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Gene RIF (10)

PMID Text
23303482 TTC12 SNP rs7130431 was associated with heroin dependence.
21168125 TTC12-ANKK1-DRD2s seemed to influence smoking behavior mainly in adolescence, and its effect is partially mediated by personality characteristics promoting drug-seeking behavior.
20133381 This study evaluated the interaction of ANKK1, TTC12, sex, and continental ancestry in tobacco smokers.
20133381 Observational study of gene-disease association. (HuGE Navigator)
18828801 Genetic linkage tests conclude that variants in TTC12 exon 3 are involved in the regulation of risk for comorbid alcohol and drug dependence.
18828801 Observational study of gene-disease association. (HuGE Navigator)
17761687 Observational study of gene-disease association. (HuGE Navigator)
17761687 association studies of alcohol dependence and 43 SNPs mapped to the gene cluster of NCAM1, TTC12, ANKK1 and DRD2
17657212 the TTC12 gene is hypermethylated in acute lymphoblastic leukemia
17085484 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDADKEKDLQKFLKNVDEISNLIQEMNSDDPVVQQKAVLETEKRLLLMEEDQEEDECRTTLNKTMISPPQ      1 - 70
TAMKSAEEINSEAFLASVEKDAKERAKRRRENKVLADALKEKGNEAFAEGNYETAILRYSEGLEKLKDMK     71 - 140
VLYTNRAQAYMKLEDYEKALVDCEWALKCDEKCTKAYFHMGKANLALKNYSVSRECYKKILEINPKLQTQ    141 - 210
VKGYLNQVDLQEKADLQEKEAHELLDSGKNTAVTTKNLLETLSKPDQIPLFYAGGIEILTEMINECTEQT    211 - 280
LFRMHNGFSIISDNEVIRRCFSTAGNDAVEEMVCVSVLKLWQAVCSRNEENQRVLVIHHDRARLLAALLS    281 - 350
SKVLAIRQQSFALLLHLAQTESGRSLIINHLDLTRLLEALVSFLDFSDKEANTAMGLFTDLALEERFQVW    351 - 420
FQANLPGVLPALTGVLKTDPKVSSSSALCQCIAIMGNLSAEPTTRRHMAACEEFGDGCLSLLARCEEDVD    421 - 490
LFREVIYTLLGLMMNLCLQAPFVSEVWAVEVSRRCLSLLNSQDGGILTRAAGVLSRTLSSSLKIVEEALR    491 - 560
AGVVKKMMKFLKTGGETASRYAIKILAICTNSYHEAREEVIRLDKKLSVMMKLLSSEDEVLVGNAALCLG    561 - 630
NCMEVPNVASSLLKTDLLQVLLKLAGSDTQKTAVQVNAGIALGKLCTAEPRFAAQLRKLHGLEILNSTMK    631 - 700
YISDS                                                                     701 - 705
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23303482 2013 ANKK1, TTC12, and NCAM1 polymorphisms and heroin dependence: importance of considering drug exposure.
23300604 2012 Transcriptional program of ciliated epithelial cells reveals new cilium and centrosome components and links to human disease.
21168125 2011 TTC12-ANKK1-DRD2 and CHRNA5-CHRNA3-CHRNB4 influence different pathways leading to smoking behavior from adolescence to mid-adulthood.
20133381 2010 Sex differences in TTC12/ANKK1 haplotype associations with daily tobacco smoking in Black and White Americans.
18828801 2008 Haplotypic variants in DRD2, ANKK1, TTC12, and NCAM1 are associated with comorbid alcohol and drug dependence.
17761687 2007 Association of haplotypic variants in DRD2, ANKK1, TTC12 and NCAM1 to alcohol dependence in independent case control and family samples.
17657212 2007 Hypermethylation of TTC12 gene in acute lymphoblastic leukemia.
17085484 2006 Haplotype spanning TTC12 and ANKK1, flanked by the DRD2 and NCAM1 loci, is strongly associated to nicotine dependence in two distinct American populations.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
More...