Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.75
PubTator Score 4.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.1e-05
ovarian cancer 8520 2.4e-05
acute myeloid leukemia 783 2.8e-02
Disease Target Count Z-score Confidence
psoriasis 6694 0.0 1.6
Disease Target Count Z-score Confidence
fructose-1,6-bisphosphatase deficiency 7 3.563 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia 1.100 2.8e-02
osteosarcoma -1.463 1.1e-05
ovarian cancer 1.100 2.4e-05

Synonym

Accession Q9H875 B4DGM2 Q8NDM6 Q96CF8
Symbols C114
KRBOX3

Gene

PDB

5XJC  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMGS      1 - 70
SAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLDAEFQKRLEKNKIAAEEQTAKRRKKRQKLKEKKLL     71 - 140
AKKMKLEQKKQEGPGQPKEQGSSSSAEASGTEEEEEVPSFTMGR                              141 - 184
//

Text Mined References (13)

PMID Year Title