Property Summary

NCBI Gene PubMed Count 27
Grant Count 1
Funding $132,850.17
PubMed Score 3.68
PubTator Score 3.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.047 0.001
osteosarcoma -1.222 0.000
astrocytoma 1.500 0.002
lung adenocarcinoma 1.100 0.000
ovarian cancer 1.500 0.001

Gene RIF (13)

PMID Text
26667495 A YAP/TAZ-miR-130/301 molecular circuit exerts systems-level control of fibrosis in a network of human diseases and physiologic conditions
25798835 activates YAP and stimulates cancer cell growth. Knockdown of ERBB3 or HBEGF eliminates YAP effects on cell growth and transformation
25597408 YY1AP1 may serve as a key molecular target for EpCAM(+) AFP(+) HCC subtype
24747426 knowledge of how YAP and TAZ function as mechanosensors and mechanotransducers
24485923 we report that YAP and its downstream transcriptional targets CCN1 and CCN2 are markedly elevated in keratinocytes in human skin basal cell carcinoma
23954413 Study reports that physical and architectural features of a multicellular sheet inform cells about their proliferative capacity through mechanical regulation of YAP and TAZ, known mediators of Hippo signaling and organ growth. YAP/TAZ activity is confined to cells exposed to mechanical stresses.
23450633 F-Actin, assembled in response to Galpha12/13 induced RhoA-GTP, promotes dephosphorylation and activation of the YAP oncogene.
23258147 The expression of YAP/TAZ and ECM-related-genes is impacted on physiologically relevant substrates. YAP was upregulated in cells on softer substrates.
22895435 Studies indicate that the transcriptional co-activators YAP and TAZ recently emerged as key mediators of the biological effects that are observed in response to extracellular matrix (ECM) elasticity and cell shape.
21278236 Data suggest that defective expression of LATS2 is attributable to FOXP3 defects and may be a major independent determinant of YAP protein elevation in cancer.
More...

AA Sequence

MEEEASRSAAATNPGSRLTRWPPPDKREGSAVDPGKRRSLAATPSSSLPCTLIALGLRHEKEANELMEDL      1 - 70
FETFQDEMGFSNMEDDGPEEEERVAEPQANFNTPQALRFEELLANLLNEQHQIAKELFEQLKMKKPSAKQ     71 - 140
QKEVEKVKPQCKEVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEASSTRICLKELGTFA    141 - 210
QSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILATSKV    211 - 280
FMYPELLPVCSLKAKNPQDKILFTKAEDNKYLLTCKTARQLTVRIKNLNMNRAPDNIIKFYKKTKQLPVL    281 - 350
GKCCEEIQPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDQGLEKDNSEL    351 - 420
GSETRYPLLLPKGVVLKLKPVADRFPKKAWRQKRSSVLKPLLIQPSPSLQPSFNPGKTPAQSTHSEAPPS    421 - 490
KMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFESPAALPAMPPEARTSFPLSESQTLLSSAPVPKVMMP    491 - 560
SPASSMFRKPYVRRRPSKRRGARAFRCIKPAPVIHPASVIFTVPATTVKIVSLGGGCNMIQPVNAAVAQS    561 - 630
PQTIPIATLLVNPTSFPCPLNQPLVASSVSPLIVSGNSVNLPIPSTPEDKAHMNVDIACAVADGENAFQG    631 - 700
LEPKLEPQELSPLSATVFPKVEHSPGPPPVDKQCQEGLSENSAYRWTVVKTEEGRQALEPLPQGIQESLN    701 - 770
NSSPGDLEEVVKMEPEDATEEISGFL                                                771 - 796
//

Text Mined References (29)

PMID Year Title
26667495 2015 A YAP/TAZ-miR-130/301 molecular circuit exerts systems-level control of fibrosis in a network of human diseases and physiologic conditions.
25798835 2015 YAP forms autocrine loops with the ERBB pathway to regulate ovarian cancer initiation and progression.
25597408 2015 Integrative genomics identifies YY1AP1 as an oncogenic driver in EpCAM(+) AFP(+) hepatocellular carcinoma.
24747426 2014 YAP/TAZ as mechanosensors and mechanotransducers in regulating organ size and tumor growth.
24485923 2014 Elevated YAP and its downstream targets CCN1 and CCN2 in basal cell carcinoma: impact on keratinocyte proliferation and stromal cell activation.
23954413 2013 A mechanical checkpoint controls multicellular growth through YAP/TAZ regulation by actin-processing factors.
23450633 2013 G protein-coupled receptors engage the mammalian Hippo pathway through F-actin: F-Actin, assembled in response to Galpha12/13 induced RhoA-GTP, promotes dephosphorylation and activation of the YAP oncogene.
23258147 2013 Role of substratum stiffness in modulating genes associated with extracellular matrix and mechanotransducers YAP and TAZ.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22895435 2012 Transduction of mechanical and cytoskeletal cues by YAP and TAZ.
More...