Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.43
PubTator Score 1.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
23349634 METTL21D trimethylates Lys-315 in VCP/p97 in a ASPCR1-dependent manner
22948820 METTL21D is the methyltransferase responsible for lysine methylation of VCP.

AA Sequence

MADTLESSLEDPLRSFVRVLEKRDGTVLRLQQYSSGGVGCVVWDAAIVLSKYLETPEFSGDGAHALSRRS      1 - 70
VLELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMNINMNKHLVTGSVQAKVLKWGEEIEGFPSPPDFI     71 - 140
LMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFELLQLDFDFEKIPLEKHDEEY    141 - 210
RSEDIHIIYIRKKKSKFPS                                                       211 - 229
//

Text Mined References (8)

PMID Year Title
23349634 2013 A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22948820 2012 Lysine methylation of VCP by a member of a novel human protein methyltransferase family.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.