Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.23
PubTator Score 0.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma 1.100 4.8e-02
astrocytoma 1.400 1.2e-14
atypical teratoid / rhabdoid tumor 2.400 1.4e-07
Barrett's esophagus -1.300 1.5e-02
cutaneous lupus erythematosus -1.100 2.0e-02
ependymoma 1.900 2.4e-06
esophageal adenocarcinoma -1.300 3.3e-02
Gaucher disease type 3 1.100 1.2e-02
glioblastoma 2.100 6.4e-08
group 3 medulloblastoma 3.500 1.3e-06
lung adenocarcinoma 1.010 2.7e-03
lung cancer 1.600 1.0e-03
medulloblastoma, large-cell 3.400 6.5e-05
nephrosclerosis 1.386 7.0e-04
oligodendroglioma 1.200 3.6e-02
ovarian cancer 1.700 3.8e-05
pancreatic cancer 1.100 2.4e-02
pancreatic carcinoma 1.100 2.4e-02
pituitary cancer -1.200 1.7e-03
primitive neuroectodermal tumor 3.000 1.4e-05
ulcerative colitis 1.100 4.9e-04
urothelial carcinoma 1.400 1.7e-02

AA Sequence

MRVESGSAQERGILLESLSTLLEKTTASHEGRAPGNRELTDLLPPEVCSLLNPAAIYANNEISLRDVEVY      1 - 70
GFDYDYTLAQYADALHPEIFSTARDILIEHYKYPEGIRKYDYNPSFAIRGLHYDIQKSLLMKIDAFHYVQ     71 - 140
LGTAYRGLQPVPDEEVIELYGGTQHIPLYQMSGFYGKGPSIKQFMDIFSLPEMALLSCVVDYFLGHSLEF    141 - 210
DQAHLYKDVTDAIRDVHVKGLMYQWIEQDMEKYILRGDETFAVLSRLVAHGKQLFLITNSPFSFVDKGMR    211 - 280
HMVGPDWRQLFDVVIVQADKPSFFTDRRKPFRKLDEKGSLQWDRITRLEKGKIYRQGNLFDFLRLTEWRG    281 - 350
PRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRIINTEQYMHSLTWQQALTGLLERMQTYQDAESR    351 - 420
QVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLNYRVDFTFYPRRT    421 - 490
PLQHEAPLWMDQLCTGCMKTPFLGDMAHIR                                            491 - 520
//

Text Mined References (12)

PMID Year Title