Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.23
PubTator Score 0.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
nephrosclerosis 1.386 0.001
pancreatic cancer 1.200 0.047
urothelial carcinoma 1.400 0.017
oligodendroglioma 1.900 0.000
Barrett's esophagus -1.300 0.015
esophageal adenocarcinoma -1.300 0.033
cutaneous lupus erythematosus -1.100 0.020
astrocytoma 1.400 0.000
glioblastoma 2.400 0.000
ependymoma 1.900 0.000
group 3 medulloblastoma 3.500 0.000
atypical teratoid / rhabdoid tumor 2.400 0.000
medulloblastoma, large-cell 3.400 0.000
primitive neuroectodermal tumor 3.000 0.000
lung cancer 1.600 0.001
pediatric high grade glioma 2.300 0.000
pancreatic carcinoma 1.100 0.024
lung adenocarcinoma 1.010 0.003
ulcerative colitis 1.100 0.000
ovarian cancer 1.700 0.000
Gaucher disease type 3 1.100 0.012
pituitary cancer -1.200 0.002

AA Sequence

MRVESGSAQERGILLESLSTLLEKTTASHEGRAPGNRELTDLLPPEVCSLLNPAAIYANNEISLRDVEVY      1 - 70
GFDYDYTLAQYADALHPEIFSTARDILIEHYKYPEGIRKYDYNPSFAIRGLHYDIQKSLLMKIDAFHYVQ     71 - 140
LGTAYRGLQPVPDEEVIELYGGTQHIPLYQMSGFYGKGPSIKQFMDIFSLPEMALLSCVVDYFLGHSLEF    141 - 210
DQAHLYKDVTDAIRDVHVKGLMYQWIEQDMEKYILRGDETFAVLSRLVAHGKQLFLITNSPFSFVDKGMR    211 - 280
HMVGPDWRQLFDVVIVQADKPSFFTDRRKPFRKLDEKGSLQWDRITRLEKGKIYRQGNLFDFLRLTEWRG    281 - 350
PRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRIINTEQYMHSLTWQQALTGLLERMQTYQDAESR    351 - 420
QVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLNYRVDFTFYPRRT    421 - 490
PLQHEAPLWMDQLCTGCMKTPFLGDMAHIR                                            491 - 520
//

Text Mined References (12)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21269460 2011 Initial characterization of the human central proteome.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
More...