Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group B ependymoma 1.700 0.000
nasopharyngeal carcinoma -1.300 0.000

Gene RIF (1)

PMID Text
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.

AA Sequence

MRHQQTERQDPSQPLSRQHGTYRQIFHPEQLITGKEDAANNYAWGHYTIGKEFIDLLLDRIRKLADQCTG      1 - 70
LQGFLVFHSLGRGTGSDVTSFLMEWLSVNYGKKSKLGFSIYPAPQVSTAMVQPYNSILTTHTTLEHSDCA     71 - 140
FMVDNKAIYDICHCNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVSYLTSTSPWPP    141 - 210
MHQSSLQKRYTTSSCWWQRLPMPALSLPTRW                                           211 - 241
//

Text Mined References (7)

PMID Year Title
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12486001 2002 HIV-1 Tat targets microtubules to induce apoptosis, a process promoted by the pro-apoptotic Bcl-2 relative Bim.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10908577 2000 HIV-1 rev depolymerizes microtubules to form stable bilayered rings.
3785200 1986 Six mouse alpha-tubulin mRNAs encode five distinct isotypes: testis-specific expression of two sister genes.