Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
nasopharyngeal carcinoma -1.300 7.4e-08
posterior fossa group B ependymoma 1.700 1.1e-06

Gene RIF (2)

AA Sequence

MRHQQTERQDPSQPLSRQHGTYRQIFHPEQLITGKEDAANNYAWGHYTIGKEFIDLLLDRIRKLADQCTG      1 - 70
LQGFLVFHSLGRGTGSDVTSFLMEWLSVNYGKKSKLGFSIYPAPQVSTAMVQPYNSILTTHTTLEHSDCA     71 - 140
FMVDNKAIYDICHCNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVSYLTSTSPWPP    141 - 210
MHQSSLQKRYTTSSCWWQRLPMPALSLPTRW                                           211 - 241
//

Text Mined References (6)

PMID Year Title