Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.500 2.5e-03
Alzheimer's disease -1.200 2.5e-02
astrocytic glioma -2.100 1.4e-03
atypical teratoid / rhabdoid tumor -2.200 4.4e-07
glioblastoma -1.700 6.6e-03
intraductal papillary-mucinous adenoma (... 1.200 5.5e-03
lung cancer -1.400 8.5e-03
malignant mesothelioma -2.700 5.3e-06
medulloblastoma -1.100 1.5e-03
medulloblastoma, large-cell 1.100 1.7e-03
oligodendroglioma -1.900 1.5e-02
osteosarcoma 1.582 7.3e-06
ovarian cancer -2.000 8.6e-07
Pick disease -2.000 2.4e-05
pituitary cancer -1.600 2.1e-04
posterior fossa group A ependymoma -1.100 2.8e-05
primitive neuroectodermal tumor -2.100 1.1e-03
tuberculosis 2.200 1.3e-08

AA Sequence

MAAVAPAGPGDSASAALDELSLNFTYGAPGAGNGSLSGDWYRRNQIHLFGVLLAILGNLVISISLNIQKY      1 - 70
SHLQLAQQEHPRPYFKSVLWWGGVLLMAVGETGNFAAYGFAPITLIAPLGCVSVTGSAIISVTFLKDNLR     71 - 140
ASDLLGTTLAFAGTYLLVNFAPNITQAISARTVQYYLVGWQFLIYVILEILIFCILLYFYKRKGMKHMVI    141 - 210
LLTLVAILASLTVISVKAVSGMITFSVMDKMQLTYPIFYIMFIIMIASCVFQVKFLNQATKLYNTTTVVP    211 - 280
VNHIFFTISAIIAGIIFYQEFLGAPFLTVFIYLFGCFLSFLGVFLVTRNREKEHLQQSYIDFGNIPDTTP    281 - 350
ERKAWRETNVGQNTTRFT                                                        351 - 368
//

Text Mined References (10)

PMID Year Title