Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -2.700 0.000
astrocytic glioma -2.100 0.001
oligodendroglioma -1.900 0.015
glioblastoma -1.700 0.007
osteosarcoma -1.764 0.003
sonic hedgehog group medulloblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -1.900 0.003
primitive neuroectodermal tumor -2.100 0.001
tuberculosis 2.200 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.005
lung cancer -2.000 0.000
adult high grade glioma -1.500 0.003
posterior fossa group A ependymoma -1.100 0.000
Alzheimer's disease -1.200 0.025
Pick disease -2.000 0.000
ovarian cancer -2.000 0.000
pituitary cancer -1.600 0.000

AA Sequence

MAAVAPAGPGDSASAALDELSLNFTYGAPGAGNGSLSGDWYRRNQIHLFGVLLAILGNLVISISLNIQKY      1 - 70
SHLQLAQQEHPRPYFKSVLWWGGVLLMAVGETGNFAAYGFAPITLIAPLGCVSVTGSAIISVTFLKDNLR     71 - 140
ASDLLGTTLAFAGTYLLVNFAPNITQAISARTVQYYLVGWQFLIYVILEILIFCILLYFYKRKGMKHMVI    141 - 210
LLTLVAILASLTVISVKAVSGMITFSVMDKMQLTYPIFYIMFIIMIASCVFQVKFLNQATKLYNTTTVVP    211 - 280
VNHIFFTISAIIAGIIFYQEFLGAPFLTVFIYLFGCFLSFLGVFLVTRNREKEHLQQSYIDFGNIPDTTP    281 - 350
ERKAWRETNVGQNTTRFT                                                        351 - 368
//

Text Mined References (10)

PMID Year Title
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15317751 2004 Mutations in ichthyin a new gene on chromosome 5q33 in a new form of autosomal recessive congenital ichthyosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11827452 2002 Gene expression profile of human bone marrow stromal cells: high-throughput expressed sequence tag sequencing analysis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.