Property Summary

NCBI Gene PubMed Count 17
PubMed Score 11.05
PubTator Score 9.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 9.5e-05
Disease Target Count Z-score Confidence
Muscular atrophy 71 4.577 2.3

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.306 9.5e-05

Gene RIF (4)

AA Sequence

MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSL      1 - 70
LAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP              71 - 131
//

Text Mined References (21)

PMID Year Title