Property Summary

NCBI Gene PubMed Count 15
Grant Count 1
Funding $52,748.5
PubMed Score 11.04
PubTator Score 9.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Muscular atrophy 67 4.64 2.3
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.131 0.000

Synonym

Accession Q9H840 Q6IA34 Gemin-7
Symbols SIP3

Gene

 Grant Application (1)

PDB

1Y96  

Gene RIF (4)

PMID Text
22190034 HIV-1 Vpr is identified to have a physical interaction with gem (nuclear organelle) associated protein 7 (GEMIN7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
17023415 Gemin8 has an essential role in the proper structural organization of the SMN complex and the involvement of the heteromeric subunit containing Gemin6, Gemin7, Gemin8, and Unrip in the recruitment of Sm proteins to the snRNP assembly pathway
16159890 Unrip is recruited to the active SMN complex via a stable interaction with Gemin7
12065586 Identification and characterization a novel protein component of the survival of motor neurons complex termed Gemin7 using native purified SMN complexes and peptide sequencing by mass spectrometry

AA Sequence

MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSL      1 - 70
LAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP              71 - 131
//

Text Mined References (20)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
18984161 2008 An assembly chaperone collaborates with the SMN complex to generate spliceosomal SnRNPs.
17023415 2006 Gemin8 is required for the architecture and function of the survival motor neuron complex.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...