Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.28
PubTator Score 5.07

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
breast carcinoma 1.400 4.0e-03
juvenile dermatomyositis 1.013 6.7e-12
lung cancer 1.200 9.6e-04
osteosarcoma 2.012 6.5e-06
ovarian cancer 1.900 4.9e-07
pancreatic cancer 1.300 4.4e-03
primary pancreatic ductal adenocarcinoma 1.203 5.5e-03

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MAESPTEEAATAGAGAAGPGASSVAGVVGVSGSGGGFGPPFLPDVWAAAAAAGGAGGPGSGLAPLPGLPP      1 - 70
SAAAHGAALLSHWDPTLSSDWDGERTAPQCLLRIKRDIMSIYKEPPPGMFVVPDTVDMTKIHALITGPFD     71 - 140
TPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVL    141 - 210
ISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYD    211 - 280
FYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHG    281 - 350
SLRV                                                                      351 - 354
//

Text Mined References (18)

PMID Year Title