Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.17
PubTator Score 5.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 2.012 0.000
juvenile dermatomyositis 1.013 0.000
primary pancreatic ductal adenocarcinoma 1.203 0.005
lung cancer 1.200 0.001
breast carcinoma 1.400 0.004
ovarian cancer 1.900 0.000
pancreatic cancer 1.300 0.004

Synonym

Accession Q9H832 A6N8M6 A6NC60 Q7L354 Q8TCM4 Q9H893
Symbols USE1
HOYS7

Gene

PDB

5A4P  

Gene RIF (4)

PMID Text
26602883 Association of UBE2Z single nucleotide polymorphism rs46522 with the susceptibility to coronary artery disease in an Iranian population.
18976975 Knockdown of ubiquitin-conjugating enzyme E2Z (UBE2Z) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17597759 In tissue culture cells, Uba6 is required for charging a previously uncharacterized Uba6-specific E2 (Use1), whereas Ube1 is required for charging the cell-cycle E2s Cdc34A and Cdc34B
17160626 UBE2Z was widely expressed in human tissues and is located on chromosome 17q21.

AA Sequence

MAESPTEEAATAGAGAAGPGASSVAGVVGVSGSGGGFGPPFLPDVWAAAAAAGGAGGPGSGLAPLPGLPP      1 - 70
SAAAHGAALLSHWDPTLSSDWDGERTAPQCLLRIKRDIMSIYKEPPPGMFVVPDTVDMTKIHALITGPFD     71 - 140
TPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVL    141 - 210
ISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYD    211 - 280
FYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHG    281 - 350
SLRV                                                                      351 - 354
//

Text Mined References (17)

PMID Year Title
26602883 2015 Evaluating the association of common UBE2Z variants with coronary artery disease in an Iranian population.
25416956 2014 A proteome-scale map of the human interactome network.
24528925 2014 Investigations into the auto-FAT10ylation of the bispecific E2 conjugating enzyme UBA6-specific E2 enzyme 1.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17597759 2007 Dual E1 activation systems for ubiquitin differentially regulate E2 enzyme charging.
17464193 2007 Identification of novel regulators of apoptosis using a high-throughput cell-based screen.
17160626 2007 Cloning and characterization of a gene encoding the human putative ubiquitin conjugating enzyme E2Z (UBE2Z).
More...