Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.200 1.1e-04
atypical teratoid / rhabdoid tumor -1.400 7.3e-05
glioblastoma -1.100 4.5e-05
medulloblastoma, large-cell -1.600 5.4e-05
osteosarcoma -2.187 4.3e-04
sonic hedgehog group medulloblastoma 1.200 7.1e-06
subependymal giant cell astrocytoma -1.517 2.7e-02

Synonym

Accession Q9H819
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MAATLGSGERWTEAYIDAVRRNKYPEDTPPESHDPCGCCNCMKAQKEKKSENEWTQTRQGEGNSTYSEEQ      1 - 70
LLGVQRIKKCRNYYEILGVSRDASDEELKKAYRKLALKFHPDKNCAPGATDAFKAIGNAFAVLSNPDKRL     71 - 140
RYDEYGDEQVTFTAPRARPYNYYRDFEADITPEELFNVFFGGHFPTGNIHMFSNVTDDTYYYRRRHRHER    141 - 210
TQTQKEEEEEKPQTTYSAFIQLLPVLVIVIISVITQLLATNPPYSLFYKSTLGYTISRETQNLQVPYFVD    211 - 280
KNFDKAYRGASLHDLEKTIEKDYIDYIQTSCWKEKQQKSELTNLAGLYRDERLKQKAESLKLENCEKLSK    281 - 350
LIGLRRGG                                                                  351 - 358
//

Text Mined References (11)

PMID Year Title