Property Summary

NCBI Gene PubMed Count 31
PubMed Score 16.04
PubTator Score 31.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 3.0
Disease Target Count Z-score Confidence
Dyskeratosis congenita 24 0.0 4.0
Disease Target Count Z-score Confidence
Fanconi anemia 56 4.552 2.3

Expression

  Differential Expression (6)

Disease log2 FC p
gastric carcinoma 1.100 4.1e-02
group 3 medulloblastoma 1.600 5.9e-04
medulloblastoma, large-cell 1.100 5.3e-03
osteosarcoma -1.202 3.2e-03
pancreatic cancer 1.100 2.0e-03
pancreatic carcinoma 1.100 2.0e-03

Gene RIF (16)

AA Sequence

MNGVLIPHTPIAVDFWSLRRAGTARLFFLSHMHSDHTVGLSSTWARPLYCSPITAHLLHRHLQVSKQWIQ      1 - 70
ALEVGESHVLPLDEIGQETMTVTLLDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIH     71 - 140
TLYLDNTNCNPALVLPSRQEAAHQIVQLIRKHPQHNIKIGLYSLGKESLLEQLALEFQTWVVLSPRRLEL    141 - 210
VQLLGLADVFTVEEKAGRIHAVDHMEICHSNMLRWNQTHPTIAILPTSRKIHSSHPDIHVIPYSDHSSYS    211 - 280
ELRAFVAALKPCQVVPIVSRRPCGGFQDSLSPRISVPLIPDSVQQYMSSSSRKPSLLWLLERRLKRPRTQ    281 - 350
GVVFESPEESADQSQADRDSKKAKKEKLSPWPADLEKQPSHHPLRIKKQLFPDLYSKEWNKAVPFCESQK    351 - 420
RVTMLTAPLGFSVHLRSTDEEFISQKTREEIGLGSPLVPMGDDDGGPEATGNQSAWMGHGSPLSHSSKGT    421 - 490
PLLATEFRGLALKYLLTPVNFFQAGYSSRRFDQQVEKYHKPC                                491 - 532
//

Text Mined References (32)

PMID Year Title