Property Summary

NCBI Gene PubMed Count 28
Grant Count 4
R01 Count 4
Funding $376,283.01
PubMed Score 14.81
PubTator Score 31.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
pancreatic cancer 1.100 0.002
osteosarcoma -1.202 0.003
group 3 medulloblastoma 1.600 0.001
medulloblastoma, large-cell 1.100 0.005
pancreatic carcinoma 1.100 0.002
gastric carcinoma 1.100 0.041

Synonym

Accession Q9H816 Q9H9E5
Symbols SNM1B
SNMIB
APOLLO

Gene

PDB

3BUA   5AHO  

Gene RIF (16)

PMID Text
26582912 Different charge distributions along the DNA binding groove may account for the drastic difference in processivity and DNA digestion efficiency, including that of damaged substrates, between SNM1A and SNM1B.
23863462 The SNM1B/APOLLO DNA nuclease functions in resolution of replication stress and maintenance of common fragile site stability.
23189151 the N-terminal region of Snm1B forms a complex containing PSF2 and Mus81, while the C-terminal region is important for PSF2-mediated chromatin association.
22907656 The nuclease hSNM1B/Apollo is linked to the Fanconi anemia pathway via its interaction with FANCP/SLX4.
22692201 differences in the substrate selectivities of SNM1A and SNM1B are likely to be relevant to their in vivo roles
21478198 SNM1B functions epistatically to the central Fanconi anemia factor, FANCD2, in cellular survival after interstrand crosslinks damage and homology-directed repair of DNA double-strand breaks
20655466 TRF2, which binds preferentially to positively supercoiled DNA substrates, together with Apollo, negatively regulates the amount of TOP1, TOP2alpha, and TOP2beta at telomeres.
19411856 DCLRE1B protein binds to a C-terminal fragment of HSP72 Heat-Shock Proteins, known to contain the substrate binding domain.
19197158 Results suggest that SNM1B/Apollo and Astrin function together to enforce the prophase checkpoint in response to spindle stress.
18593705 The protein hSnm1B is stabilized when bound to the telomere-binding protein TRF2
More...

AA Sequence

MNGVLIPHTPIAVDFWSLRRAGTARLFFLSHMHSDHTVGLSSTWARPLYCSPITAHLLHRHLQVSKQWIQ      1 - 70
ALEVGESHVLPLDEIGQETMTVTLLDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIH     71 - 140
TLYLDNTNCNPALVLPSRQEAAHQIVQLIRKHPQHNIKIGLYSLGKESLLEQLALEFQTWVVLSPRRLEL    141 - 210
VQLLGLADVFTVEEKAGRIHAVDHMEICHSNMLRWNQTHPTIAILPTSRKIHSSHPDIHVIPYSDHSSYS    211 - 280
ELRAFVAALKPCQVVPIVSRRPCGGFQDSLSPRISVPLIPDSVQQYMSSSSRKPSLLWLLERRLKRPRTQ    281 - 350
GVVFESPEESADQSQADRDSKKAKKEKLSPWPADLEKQPSHHPLRIKKQLFPDLYSKEWNKAVPFCESQK    351 - 420
RVTMLTAPLGFSVHLRSTDEEFISQKTREEIGLGSPLVPMGDDDGGPEATGNQSAWMGHGSPLSHSSKGT    421 - 490
PLLATEFRGLALKYLLTPVNFFQAGYSSRRFDQQVEKYHKPC                                491 - 532
//

Text Mined References (30)

PMID Year Title
26582912 2015 The structures of the SNM1A and SNM1B/Apollo nuclease domains reveal a potential basis for their distinct DNA processing activities.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
23863462 2013 The SNM1B/APOLLO DNA nuclease functions in resolution of replication stress and maintenance of common fragile site stability.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23189151 2012 Snm1B interacts with PSF2.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22907656 2012 The nuclease hSNM1B/Apollo is linked to the Fanconi anemia pathway via its interaction with FANCP/SLX4.
22692201 2012 Characterization of the human SNM1A and SNM1B/Apollo DNA repair exonucleases.
21478198 2011 Snm1B/Apollo functions in the Fanconi anemia pathway in response to DNA interstrand crosslinks.
More...