Property Summary

NCBI Gene PubMed Count 12
Grant Count 6
R01 Count 6
Funding $693,021
PubMed Score 13.38
PubTator Score 9.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
gastric cancer 1.200 0.014
hepatocellular carcinoma 1.400 0.000
pancreatic cancer 1.200 0.036
atypical teratoid / rhabdoid tumor -1.200 0.001
glioblastoma -1.200 0.001
medulloblastoma, large-cell -1.300 0.000
diabetes mellitus -1.300 0.002
pancreatic carcinoma 1.200 0.036
ovarian cancer 1.300 0.018

Gene RIF (2)

PMID Text
20430857 PHAX RNA-binding domain mediates auxiliary RNA contracts with small nuclear and mall nucleolar RNA substrates.
15574332 PHAX and CRM1 have roles in transporting U3 snoRNA to nucleoli

AA Sequence

MALEVGDMEDGQLSDSDSDMTVAPSDRPLQLPKVLGGDSAMRAFQNTATACAPVSHYRAVESVDSSEESF      1 - 70
SDSDDDSCLWKRKRQKCFNPPPKPEPFQFGQSSQKPPVAGGKKINNIWGAVLQEQNQDAVATELGILGME     71 - 140
GTIDRSRQSETYNYLLAKKLRKESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRPVKDRLGNR    141 - 210
PEMNYKGRYEITAEDSQEKVADEISFRLQEPKKDLIARVVRIIGNKKAIELLMETAEVEQNGGLFIMNGS    211 - 280
RRRTPGGVFLNLLKNTPSISEEQIKDIFYIENQKEYENKKAARKRRTQVLGKKMKQAIKSLNFQEDDDTS    281 - 350
RETFASDTNEALASLDESQEGHAEAKLEAEEAIEVDHSHDLDIF                              351 - 394
//

Text Mined References (18)

PMID Year Title
26382858 2015 mRNA export through an additional cap-binding complex consisting of NCBP1 and NCBP3.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20430857 2010 Structure and RNA recognition by the snRNA and snoRNA transport factor PHAX.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16687569 2006 Ongoing U snRNP biogenesis is required for the integrity of Cajal bodies.
15574333 2004 Assembly and maturation of the U3 snoRNP in the nucleoplasm in a large dynamic multiprotein complex.
More...