Property Summary

NCBI Gene PubMed Count 12
PubMed Score 14.33
PubTator Score 9.24

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 6.6e-04
diabetes mellitus -1.300 1.7e-03
gastric cancer 1.200 1.4e-02
glioblastoma -1.200 8.3e-04
hepatocellular carcinoma 1.400 2.4e-04
medulloblastoma, large-cell -1.300 1.7e-04
ovarian cancer 1.300 1.8e-02
pancreatic cancer 1.200 3.6e-02
pancreatic carcinoma 1.200 3.6e-02

Gene RIF (2)

AA Sequence

MALEVGDMEDGQLSDSDSDMTVAPSDRPLQLPKVLGGDSAMRAFQNTATACAPVSHYRAVESVDSSEESF      1 - 70
SDSDDDSCLWKRKRQKCFNPPPKPEPFQFGQSSQKPPVAGGKKINNIWGAVLQEQNQDAVATELGILGME     71 - 140
GTIDRSRQSETYNYLLAKKLRKESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRPVKDRLGNR    141 - 210
PEMNYKGRYEITAEDSQEKVADEISFRLQEPKKDLIARVVRIIGNKKAIELLMETAEVEQNGGLFIMNGS    211 - 280
RRRTPGGVFLNLLKNTPSISEEQIKDIFYIENQKEYENKKAARKRRTQVLGKKMKQAIKSLNFQEDDDTS    281 - 350
RETFASDTNEALASLDESQEGHAEAKLEAEEAIEVDHSHDLDIF                              351 - 394
//

Text Mined References (18)

PMID Year Title