Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease 1.049 2.0e-02
active ulcerative colitis 1.037 8.2e-03
ductal carcinoma in situ 1.800 2.5e-04
gastric carcinoma 1.500 1.3e-02
interstitial cystitis 1.100 4.1e-03
invasive ductal carcinoma 2.000 1.4e-04
medulloblastoma, large-cell 1.100 1.0e-04
Pick disease -1.500 1.3e-03
primary Sjogren syndrome 1.200 2.4e-03

AA Sequence

MIRQERSTSYQELSEELVQVVENSELADEQDKETVRVQGPGILPGLDSESASSSIRFSKACLKNVFSVLL      1 - 70
IFIYLLLMAVAVFLVYRTITDFREKLKHPVMSVSYKEVDRYDAPGIALYPGQAQLLSCKHHYEVIPPLTS     71 - 140
PGQPGDMNCTTQRINYTDPFSNQTVKSALIVQGPREVKKRELVFLQFRLNKSSEDFSAIDYLLFSSFQEF    141 - 210
LQSPNRVGFMQACESAYSSWKFSGGFRTWVKMSLVKTKEEDGREAVEFRQETSVVNYIDQRPAAKKSAQL    211 - 280
FFVVFEWKDPFIQKVQDIVTANPWNTIALLCGAFLALFKAAEFAKLSIKWMIKIRKRYLKRRGQATSHIS    281 - 350
//

Text Mined References (11)

PMID Year Title