Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.12
PubTator Score 1.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count Z-score Confidence
Infertility 163 3.024 1.5
Disease Target Count
Preimplantation embryonic lethality 1

Expression

Synonym

Accession Q9H808 J3KMZ1
Symbols GRG6
PREMBL

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG

Gene RIF (3)

PMID Text
26537248 In this first report of a human defect in a member of the subcortical maternal subcritical maternal complex, we show that the TLE6 mutation is gender-specific and leads to the earliest known human embryonic lethality phenotype
24356439 transcriptional programmes regulated by FOXG1 and Groucho/TLE are important for BTIC-initiated brain tumour growth, implicating FOXG1 and Groucho/TLE in GBM tumourigenesis
18551179 Expression of Tle6-like in colon cancer cells increased cell proliferation, colony-formation, cell migration, and xenograft tumorgenicity.

AA Sequence

MTSRDQPRPKGPPKSTSPCPGISNSESSPTLNYQGILNRLKQFPRFSPHFAAELESIYYSLHKIQQDVAE      1 - 70
HHKQIGNVLQIVESCSQLQGFQSEEVSPAEPASPGTPQQVKDKTLQESSFEDIMATRSSDWLRRPLGEDN     71 - 140
QPETQLFWDKEPWFWHDTLTEQLWRIFAGVHDEKAKPRDRQQAPGLGQESKAPGSCDPGTDPCPEDASTP    141 - 210
RPPEASSSPPEGSQDRNTSWGVVQEPPGRASRFLQSISWDPEDFEDAWKRPDALPGQSKRLAVPCKLEKM    211 - 280
RILAHGELVLATAISSFTRHVFTCGRRGIKVWSLTGQVAEDRFPESHLPIQTPGAFLRTCLLSSNSRSLL    281 - 350
TGGYNLASVSVWDLAAPSLHVKEQLPCAGLNCQALDANLDANLAFASFTSGVVRIWDLRDQSVVRDLKGY    351 - 420
PDGVKSIVVKGYNIWTGGPDACLRCWDQRTIMKPLEYQFKSQIMSLSHSPQEDWVLLGMANGQQWLQSTS    421 - 490
GSQRHMVGQKDSVILSVKFSPFGQWWASVGMDDFLGVYSMPAGTKVFEVPEMSPVTCCDVSSNNRLVVTG    491 - 560
SGEHASVYQITY                                                              561 - 572
//

Text Mined References (12)

PMID Year Title
27525657 2016 The subcortical maternal complex: multiple functions for one biological structure?
26537248 2015 TLE6 mutation causes the earliest known human embryonic lethality.
25542835 2015 Identification of a human subcortical maternal complex.
24356439 2013 Transcription factors FOXG1 and Groucho/TLE promote glioblastoma growth.
18551179 2008 Novel roles for MLH3 deficiency and TLE6-like amplification in DNA mismatch repair-deficient gastrointestinal tumorigenesis and progression.
18254933 2008 The Groucho/TLE/Grg family of transcriptional co-repressors.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...