Property Summary

NCBI Gene PubMed Count 10
Grant Count 7
R01 Count 5
Funding $646,826.1
PubMed Score 7.12
PubTator Score 1.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Infertility 163 3.024 1.5

Expression

Gene RIF (3)

PMID Text
26537248 In this first report of a human defect in a member of the subcortical maternal subcritical maternal complex, we show that the TLE6 mutation is gender-specific and leads to the earliest known human embryonic lethality phenotype
24356439 transcriptional programmes regulated by FOXG1 and Groucho/TLE are important for BTIC-initiated brain tumour growth, implicating FOXG1 and Groucho/TLE in GBM tumourigenesis
18551179 Expression of Tle6-like in colon cancer cells increased cell proliferation, colony-formation, cell migration, and xenograft tumorgenicity.

AA Sequence

MTSRDQPRPKGPPKSTSPCPGISNSESSPTLNYQGILNRLKQFPRFSPHFAAELESIYYSLHKIQQDVAE      1 - 70
HHKQIGNVLQIVESCSQLQGFQSEEVSPAEPASPGTPQQVKDKTLQESSFEDIMATRSSDWLRRPLGEDN     71 - 140
QPETQLFWDKEPWFWHDTLTEQLWRIFAGVHDEKAKPRDRQQAPGLGQESKAPGSCDPGTDPCPEDASTP    141 - 210
RPPEASSSPPEGSQDRNTSWGVVQEPPGRASRFLQSISWDPEDFEDAWKRPDALPGQSKRLAVPCKLEKM    211 - 280
RILAHGELVLATAISSFTRHVFTCGRRGIKVWSLTGQVAEDRFPESHLPIQTPGAFLRTCLLSSNSRSLL    281 - 350
TGGYNLASVSVWDLAAPSLHVKEQLPCAGLNCQALDANLDANLAFASFTSGVVRIWDLRDQSVVRDLKGY    351 - 420
PDGVKSIVVKGYNIWTGGPDACLRCWDQRTIMKPLEYQFKSQIMSLSHSPQEDWVLLGMANGQQWLQSTS    421 - 490
GSQRHMVGQKDSVILSVKFSPFGQWWASVGMDDFLGVYSMPAGTKVFEVPEMSPVTCCDVSSNNRLVVTG    491 - 560
SGEHASVYQITY                                                              561 - 572
//

Text Mined References (12)

PMID Year Title
27525657 2016 The subcortical maternal complex: multiple functions for one biological structure?
26537248 2015 TLE6 mutation causes the earliest known human embryonic lethality.
25542835 2015 Identification of a human subcortical maternal complex.
24356439 2013 Transcription factors FOXG1 and Groucho/TLE promote glioblastoma growth.
18551179 2008 Novel roles for MLH3 deficiency and TLE6-like amplification in DNA mismatch repair-deficient gastrointestinal tumorigenesis and progression.
18254933 2008 The Groucho/TLE/Grg family of transcriptional co-repressors.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...