Property Summary

NCBI Gene PubMed Count 55
PubMed Score 198.44
PubTator Score 272.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.600 6.3e-06
osteosarcoma -1.203 1.6e-03
ovarian cancer 1.200 5.9e-04

Protein-protein Interaction (1)

Gene RIF (45)

AA Sequence

MAAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGEPEVTVEIGETYLCRRPDSTW      1 - 70
HSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITR     71 - 140
NQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLC    141 - 210
EYCLKYMKYEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDV    211 - 280
EPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPE    281 - 350
KPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPK    351 - 420
LVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK                                    421 - 458
//

Text Mined References (65)

PMID Year Title