Property Summary

NCBI Gene PubMed Count 47
Grant Count 41
R01 Count 33
Funding $3,833,377.64
PubMed Score 181.95
PubTator Score 272.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
osteosarcoma -1.203 0.002
ovarian cancer 1.200 0.001

Gene RIF (37)

PMID Text
26960573 Along with the PHF20/MOF complex, G9a links the crosstalk between ERalpha methylation and histone acetylation that governs the epigenetic regulation of hormonal gene expression.
26091365 MOF is highly enriched in induced pluripotent stem cells (iPSCs), and MOF expression is upregulated during the reprogramming process. The ectopic expression of MOF promotes reprogramming. MOF affects Wdr5 and endogenous Oct4 expression.
26032517 EZH2 (enhancer of zeste homolog 2) was up-regulated in human oral tongue squamous cell carcinoma tissues and its level positively correlated with level of hMOF.
25873202 Data found downregulation of hMOF in gastric cancer cells and tissues. Declined hMOF expression, but not high level of HDAC4, may account for global histone H4K16ac suggesting that loss of hMOF expression may be involved in gastric cancer progression.
25483274 Results show the expression of hMOF mRNA and protein was significantly downregulated in ovarian epithelial cancer tissues, and patients with high hMOF levels showed improved survival as compared to those with low hMOF levels.
25181338 The histone acetyltransferase hMOF suppresses hepatocellular carcinoma growth by targeting the expression of SIRT6.
24953651 Mutant MOF-T392A expression abrogates DSB repair in S/G2 phase cells. MOF-T392A has delayed 53BP1 dissociation and decreased DNA association.
24898892 MOF mediates Notch signaling by manipulating Histone H4 acetylation.
24802406 MOF expression was down-regulated in failing hearts at protein and mRNA levels.
24702180 Functional interactions of MYST1 with androgen receptor and NF-KB are critical for prostate cancer progression.
More...

AA Sequence

MAAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGEPEVTVEIGETYLCRRPDSTW      1 - 70
HSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITR     71 - 140
NQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLC    141 - 210
EYCLKYMKYEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDV    211 - 280
EPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPE    281 - 350
KPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPK    351 - 420
LVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK                                    421 - 458
//

Text Mined References (57)

PMID Year Title
26960573 2016 G9a-mediated methylation of ER? links the PHF20/MOF histone acetyltransferase complex to hormonal gene expression.
26091365 2015 The Histone Acetyltransferase MOF Promotes Induces Generation of Pluripotent Stem Cells.
26032517 2015 hMOF (human males absent on the first), an oncogenic protein of human oral tongue squamous cell carcinoma, targeting EZH2 (enhancer of zeste homolog 2).
25873202 2015 Expression of hMOF, but not HDAC4, is responsible for the global histone H4K16 acetylation in gastric carcinoma.
25483274 2015 Expression of hMOF in different ovarian tissues and its effects on ovarian cancer prognosis.
25181338 2014 The histone acetyltransferase hMOF suppresses hepatocellular carcinoma growth.
24953651 2014 MOF phosphorylation by ATM regulates 53BP1-mediated double-strand break repair pathway choice.
24898892 2014 MDM2-MOF-H4K16ac axis contributes to tumorigenesis induced by Notch.
24802406 2014 The histone acetyltransferase MOF overexpression blunts cardiac hypertrophy by targeting ROS in mice.
24702180 2014 Coactivator MYST1 regulates nuclear factor-?B and androgen receptor functions during proliferation of prostate cancer cells.
More...