Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.91
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 5.1e-08
Pick disease 1894 1.8e-04
colon cancer 1478 3.7e-03
ovarian cancer 8519 5.2e-03
osteosarcoma 7950 1.6e-02
Disease Target Count Z-score Confidence
Bardet-Biedl syndrome 51 3.41 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer 1.300 3.7e-03
ependymoma 1.200 5.1e-08
osteosarcoma 1.062 1.6e-02
ovarian cancer 1.100 5.2e-03
Pick disease 1.300 1.8e-04

 IMPC Phenotype (1)

AA Sequence

MLKAKILFVGPCESGKTVLANFLTESSDITEYSPTQGVRILEFENPHVTSNNKGTGCEFELWDCGGDAKF      1 - 70
ESCWPALMKDAHGVVIVFNADIPSHRKEMEMWYSCFVQQPSLQDTQCMLIAHHKPGSGDDKGSLSLSPPL     71 - 140
NKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRDREEMSIMT                             141 - 185
//

Text Mined References (12)

PMID Year Title