Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
astrocytoma -3.900 0.000
ependymoma -3.900 0.001
oligodendroglioma -3.000 0.000
Barrett's esophagus 1.500 0.016
esophageal adenocarcinoma 1.400 0.020
psoriasis -1.500 0.000
glioblastoma -4.500 0.000
medulloblastoma -2.000 0.005
atypical teratoid / rhabdoid tumor -2.600 0.000
medulloblastoma, large-cell -3.600 0.000
primitive neuroectodermal tumor -3.300 0.000
non-small cell lung cancer -1.634 0.000
breast carcinoma -1.200 0.000
adult high grade glioma -3.100 0.000
pilocytic astrocytoma -3.000 0.000
acute myeloid leukemia -1.200 0.034
lung adenocarcinoma -1.700 0.000
invasive ductal carcinoma -2.000 0.008
ulcerative colitis -1.500 0.000
pituitary cancer 1.800 0.000

AA Sequence

MTVGARLRSKAESSLLRRGPRGRGRTEGDEEAAAILEHLEYADEAEAAAESGTSAADERGPGTRGARRVH      1 - 70
FALLPERYEPLEEPAPSEQPRKRYRRKLKKYGKNVGKVIIKGCRYVVIGLQGFAAAYSAPFAVATSVVSF     71 - 140
VR                                                                        141 - 142
//

Text Mined References (6)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.