Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute myeloid leukemia -1.200 3.4e-02
adult high grade glioma -3.100 4.1e-04
astrocytic glioma -3.300 3.5e-03
Astrocytoma, Pilocytic -3.000 7.9e-07
atypical teratoid / rhabdoid tumor -2.600 9.8e-05
Barrett's esophagus 1.500 1.6e-02
breast carcinoma -1.200 2.6e-05
ependymoma -3.900 9.5e-04
esophageal adenocarcinoma 1.400 2.0e-02
glioblastoma -2.800 3.8e-08
invasive ductal carcinoma -2.000 8.3e-03
lung adenocarcinoma -1.700 1.5e-10
malignant mesothelioma -1.500 1.5e-05
medulloblastoma -1.400 1.3e-02
medulloblastoma, large-cell -3.600 1.8e-04
non-small cell lung cancer -1.634 5.5e-19
oligodendroglioma -2.500 1.8e-02
pituitary cancer 1.800 3.8e-05
primitive neuroectodermal tumor -3.300 1.0e-04
psoriasis -1.500 6.6e-08
ulcerative colitis -1.500 3.4e-06

Synonym

Accession Q9H7X2 B3KRN3 D3DTB2
Symbols

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

AA Sequence

MTVGARLRSKAESSLLRRGPRGRGRTEGDEEAAAILEHLEYADEAEAAAESGTSAADERGPGTRGARRVH      1 - 70
FALLPERYEPLEEPAPSEQPRKRYRRKLKKYGKNVGKVIIKGCRYVVIGLQGFAAAYSAPFAVATSVVSF     71 - 140
VR                                                                        141 - 142
//

Text Mined References (6)

PMID Year Title