Property Summary

NCBI Gene PubMed Count 15
PubMed Score 24.46
PubTator Score 6.46

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.100 3.1e-04
astrocytoma 1.100 1.0e-03
malignant mesothelioma 1.100 4.7e-06
medulloblastoma, large-cell -1.300 1.2e-03
ovarian cancer 1.800 3.4e-08

 GO Component (1)

Gene RIF (6)

AA Sequence

MTEVVPSSALSEVSLRLLCHDDIDTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYRGAIVGMIVAE      1 - 70
IKNRTKIHKEDGDILASNFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVL     71 - 140
TTNNTAINFYENRDFKQHHYLPYYYSIRGVLKDGFTYVLYINGGHPPWTILDYIQHLGSALASLSPCSIP    141 - 210
HRVYRQAHSLLCSFLPWSGISSKSGIEYSRTM                                          211 - 242
//

Text Mined References (17)

PMID Year Title