Property Summary

NCBI Gene PubMed Count 13
PubMed Score 24.32
PubTator Score 6.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
astrocytoma 1.100 0.001
medulloblastoma, large-cell -1.300 0.001
adult high grade glioma -1.100 0.000
ovarian cancer 1.800 0.000

Synonym

Accession Q9H7X0 B3KRQ0 B4DLZ0 B4DPZ8 B4DYC4 D3DUC2 E7EQ65 Q6IA31 Q6UX26
Symbols HAT4
NAT15

Gene

PANTHER Protein Class (2)

PDB

5HGZ   5ICV   5ICW  

Gene RIF (5)

PMID Text
27320834 The first crystal structure of the N-terminal acetyltransferase Naa60 reveals two elongated loops important for substrate-specific binding not found in other NAT structures.
26164078 Knockdown of the N-terminal acetyltransferase Naa60 compromises Golgi ribbon integrity.
25732826 Naa60 is necessary for maintenance of the Golgi ribbon through its Nt-acetylation of substrate protein(s) that is/are involved in Golgi ribbon structural and/or functional organization.
21981917 HAT4 is an important player in the organization and function of the genome and may contribute to the diversity and complexity of higher eukaryotic organisms [HAT4]
21750686 Naa60 is an N-terminal acetyltransferase defined as NatF. Human and Drosophila melanogaster Naa60 acetylate Met-Lys- and other Met-starting N-termini. In Drosophila cells, NAA60 knockdown induced chromosomal segregation defects.

AA Sequence

MTEVVPSSALSEVSLRLLCHDDIDTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYRGAIVGMIVAE      1 - 70
IKNRTKIHKEDGDILASNFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVL     71 - 140
TTNNTAINFYENRDFKQHHYLPYYYSIRGVLKDGFTYVLYINGGHPPWTILDYIQHLGSALASLSPCSIP    141 - 210
HRVYRQAHSLLCSFLPWSGISSKSGIEYSRTM                                          211 - 242
//

Text Mined References (15)

PMID Year Title
27320834 2016 Crystal Structure of the Golgi-Associated Human N?-Acetyltransferase 60 Reveals the Molecular Determinants for Substrate-Specific Acetylation.
26164078 2015 Holding it together: Naa60 at the Golgi.
25732826 2015 An organellar n?-acetyltransferase, naa60, acetylates cytosolic N termini of transmembrane proteins and maintains Golgi integrity.
24057671 2014 Genome-wide association study of ancestry-specific TB risk in the South African Coloured population.
21981917 2011 HAT4, a Golgi apparatus-anchored B-type histone acetyltransferase, acetylates free histone H4 and facilitates chromatin assembly.
21750686 2011 NatF contributes to an evolutionary shift in protein N-terminal acetylation and is important for normal chromosome segregation.
21593219 2011 Methylation screening of reciprocal genome-wide UPDs identifies novel human-specific imprinted genes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
More...