Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.09
PubTator Score 1.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (1)

AA Sequence

MDGIIEQKSMLVHSKISDAGKRNGLINTRNLMAESRDGLVSVYPAPQYQSHRVGASTVPASLDSSRSEPM      1 - 70
QQLLDPNTLQQSVESRYRPNIILYSEGVLRSWGDGVAADCCETTFIEDRSPTKDSLEYPDGKFIDLSADD     71 - 140
IKIHTLSYDVEEEEEFQELESDYSSDTESEDNFLMMPPRDHLGLSVFSMLCCFWPLGIAAFYLSHETNKA    141 - 210
VAKGDLHQASTSSRRALFLAVLSITIGTGVYVGVAVALIAYLSKNNHL                          211 - 258
//

Text Mined References (10)

PMID Year Title