Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.09
PubTator Score 1.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
oligodendroglioma 2849 8.57691392328263E-14
ovarian cancer 8492 3.06136901703917E-8
atypical teratoid / rhabdoid tumor 4369 1.33035392977731E-7
group 4 medulloblastoma 1875 1.17260231522056E-6
invasive ductal carcinoma 2950 2.2094476235654E-4
pediatric high grade glioma 2712 0.00290363610094415
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00304120618040918
glioblastoma 5572 0.00547680451739553
primitive neuroectodermal tumor 3031 0.00734187756090642
non-inflammatory breast cancer 208 0.00784686439444941
osteosarcoma 7933 0.00834388337485419
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0264256639037862
medulloblastoma, large-cell 6234 0.0291672860775133

Expression

Synonym

Accession Q9H7V2 Q6IA30 Q9H514 SynDIG1
Symbols DSPC2
IFITMD5
TMEM90B
C20orf39

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDGIIEQKSMLVHSKISDAGKRNGLINTRNLMAESRDGLVSVYPAPQYQSHRVGASTVPASLDSSRSEPM      1 - 70
QQLLDPNTLQQSVESRYRPNIILYSEGVLRSWGDGVAADCCETTFIEDRSPTKDSLEYPDGKFIDLSADD     71 - 140
IKIHTLSYDVEEEEEFQELESDYSSDTESEDNFLMMPPRDHLGLSVFSMLCCFWPLGIAAFYLSHETNKA    141 - 210
VAKGDLHQASTSSRRALFLAVLSITIGTGVYVGVAVALIAYLSKNNHL                          211 - 258
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22363774 2012 The dispanins: a novel gene family of ancient origin that contains 14 human members.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20152115 2010 SynDIG1: an activity-regulated, AMPA- receptor-interacting transmembrane protein that regulates excitatory synapse development.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.