Property Summary

NCBI Gene PubMed Count 10
Grant Count 4
R01 Count 4
Funding $418,608
PubMed Score 6.09
PubTator Score 1.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H7V2 Q6IA30 Q9H514 SynDIG1
Symbols DSPC2
IFITMD5
TMEM90B
C20orf39

Gene

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDGIIEQKSMLVHSKISDAGKRNGLINTRNLMAESRDGLVSVYPAPQYQSHRVGASTVPASLDSSRSEPM      1 - 70
QQLLDPNTLQQSVESRYRPNIILYSEGVLRSWGDGVAADCCETTFIEDRSPTKDSLEYPDGKFIDLSADD     71 - 140
IKIHTLSYDVEEEEEFQELESDYSSDTESEDNFLMMPPRDHLGLSVFSMLCCFWPLGIAAFYLSHETNKA    141 - 210
VAKGDLHQASTSSRRALFLAVLSITIGTGVYVGVAVALIAYLSKNNHL                          211 - 258
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22363774 2012 The dispanins: a novel gene family of ancient origin that contains 14 human members.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20152115 2010 SynDIG1: an activity-regulated, AMPA- receptor-interacting transmembrane protein that regulates excitatory synapse development.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.