Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.8e-04

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.600 2.8e-04

Synonym

Accession Q9H7T3 A0AVQ7
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MERSNAATKCGEEPRSGSRRLPKAEGDKSGSAGAPSKNSSRLGGRPCMCTAGRRPNRASGRRRRSCSPAP      1 - 70
TWPPLCCYPQSRPTASAAGPGACMRASGRPHGNTTASTAPPRHPRPRRPGGPALRPTPRPCAGPAPPPAS     71 - 140
RDCRCRRPRRWPRAGRRGRRAGACKPSCAGAAWSARGAPLCSYRTSCAGSCGARTAPTPAPTCASPSAAA    141 - 210
SSCCRRRRACSSPTTAWSGACGAGPTAATAAQPGKPRSAAAPGRARA                           211 - 257
//

Text Mined References (6)

PMID Year Title