Property Summary

NCBI Gene PubMed Count 16
Grant Count 5
R01 Count 3
Funding $622,607.34
PubMed Score 17.36
PubTator Score 15.09

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H7S9 Q5XG76
Symbols NLZ1
ZPO1
ZEPPO1
ZNF503L

Gene

Gene RIF (10)

PMID Text
26063961 Results show that ZNF703 overexpression is associated with adverse prognosis in head and neck squamous cell carcinomas, which might be a novel biomarker for this type of neoplasm.
25742952 ZNF703 was a target of SPRY4-IT1.
25017610 Results show that ZNF703 expression is upregulated in colorectal cancer tissues (CRC) and is significantly correlated with tumor size, pathological grading, and serosal and lymph node metastasis suggesting that it may act as an oncogene in CRC.
24481460 The results showed that ZNF703 acts as a gastric cancer oncogene
24156016 High expression of ZNF703 independent of amplification indicates worse prognosis in patients with luminal B breast cancer.
23991038 Data indicate that ZNF703 overexpression in MCF-7 breast cancer cells activated the Akt/mTOR signaling pathway, downregulated ERalpha, and reduced the antitumor effect of tamoxifen.
22886885 The conserved domains are essential for proper subcellular localization and transcriptional repression of the NLZ1/ZNF703 protein.
21337521 These data strongly point to ZNF703 as a novel oncogene in Luminal B breast cancer.
21328542 ZNF703 expression results in the activation of stem cell-related gene expression leading to an increase in cancer stem cells.
19330026 Data show that FGFR1 and DDHD2 at 8p12 cooperated functionally with MYC, whereas CCND1 and ZNF703 cooperated with a dominant negative form of TP53.

AA Sequence

MSDSPAGSNPRTPESSGSGSGGGGKRPAVPAAVSLLPPADPLRQANRLPIRVLKMLSAHTGHLLHPEYLQ      1 - 70
PLSSTPVSPIELDAKKSPLALLAQTCSQIGKPDPPPSSKLNSVAAAANGLGAEKDPGRSAPGAASAAAAL     71 - 140
KQLGDSPAEDKSSFKPYSKGSGGGDSRKDSGSSSVSSTSSSSSSSPGDKAGFRVPSAACPPFPPHGAPVS    141 - 210
ASSSSSSPGGSRGGSPHHSDCKNGGGVGGGELDKKDQEPKPSPEPAAVSRGGGGEPGAHGGAESGASGRK    211 - 280
SEPPSALVGAGHVAPVSPYKPGHSVFPLPPSSIGYHGSIVGAYAGYPSQFVPGLDPSKSGLVGGQLSGGL    281 - 350
GLPPGKPPSSSPLTGASPPSFLQGLCRDPYCLGGYHGASHLGGSSCSTCSAHDPAGPSLKAGGYPLVYPG    351 - 420
HPLQPAALSSSAAQAALPGHPLYTYGFMLQNEPLPHSCNWVAASGPCDKRFATSEELLSHLRTHTALPGA    421 - 490
EKLLAAYPGASGLGSAAAAAAAAASCHLHLPPPAAPGSPGSLSLRNPHTLGLSRYHPYGKSHLSTAGGLA    491 - 560
VPSLPTAGPYYSPYALYGQRLASASALGYQ                                            561 - 590
//

Text Mined References (19)

PMID Year Title
26063961 2015 Elevated ZNF703 Protein Expression Is an Independent Unfavorable Prognostic Factor for Survival of the Patients with Head and Neck Squamous Cell Carcinoma.
25742952 2015 The long noncoding RNA SPRY4-IT1 increases the proliferation of human breast cancer cells by upregulating ZNF703 expression.
25017610 2014 ZNF703 promotes tumor cell proliferation and invasion and predicts poor prognosis in patients with colorectal cancer.
24481460 2014 ZNF703 acts as an oncogene that promotes progression in gastric cancer.
24156016 2013 High expression of ZNF703 independent of amplification indicates worse prognosis in patients with luminal B breast cancer.
23991038 2013 Luminal breast cancer cell lines overexpressing ZNF703 are resistant to tamoxifen through activation of Akt/mTOR signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22886885 2013 Characterization of human NLZ1/ZNF703 identifies conserved domains essential for proper subcellular localization and transcriptional repression.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
21337521 2011 ZNF703 is a common Luminal B breast cancer oncogene that differentially regulates luminal and basal progenitors in human mammary epithelium.
More...