Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
group 4 medulloblastoma 1875 1.29741670627723E-5
malignant mesothelioma 3163 4.02359252654051E-5
osteosarcoma 7933 8.10415067834771E-5
Disease Target Count Z-score Confidence
Asthma 349 0.0 1.0

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
osteosarcoma 1.667 0.000
group 4 medulloblastoma 1.200 0.000

Synonym

Accession Q9H7R5 A8K5T8
Symbols ZFP160L

Gene

  Ortholog (2)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG

AA Sequence

MGEAFYTVKLERLESCDTVGLSFQEVQKNTYDFECQWKDDEGNYKTVLMLQKENLPGRRAQRDRRAAGNR      1 - 70
HIENQLGVSFQSHLPELQQFQHEGKIYEYNQVEKSPNNRGKHYKCDECGKVFSQNSRLTSHKRIHTGEKP     71 - 140
YQCNKCGKAFTVRSNLTIHQVIHTGEKPYKCNECGKVFSQPSNLAGHQRIHTGEKPYKCNECGKAFRAHS    141 - 210
KLTTHQVIHTGEKPYKCKECGKCFTQNSHLASHRRIHTGEKPYKCNECGKAFSVRSSLTTHQTIHTGEKP    211 - 280
YKCNECGKVFRHNSYLAKHRRIHTGEKPYKCNECGKAFSMHSNLTKHQIIHTGEKPFKCNECVKVFTQYS    281 - 350
HLANHRRIHTGEKPYRCDECGKAFSVRSSLTTHQAIHTGEKPYKCNDCGKVFTQNSHLASHRGIHSGEKP    351 - 420
YKCDECGKAFSQTSQLARHWRVHTGEKPYKCNECGKAFSVHSSLTIHQTIHTGQKPYKCNDCGKVFRHNS    421 - 490
YLAIHQRIHTGEKPYKCNECGKAFSVHSNLATHQVIHTGEKPYKCNECGKVFTQNSHLANHRRIHTGEKP    491 - 560
YRCNECGKAFSVRSTLTTHMAVHTGDKPYKCNQCGKVFTQNSNLAKHRRIHSG                     561 - 613
//

Text Mined References (4)

PMID Year Title
22561531 2012 Genome-wide association study to identify genetic determinants of severe asthma.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.