Property Summary

NCBI Gene PubMed Count 18
PubMed Score 10.65
PubTator Score 4.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -1.700 9.1e-14
malignant mesothelioma -1.900 1.3e-06
non-small cell lung cancer -1.203 2.2e-17
psoriasis 1.100 1.3e-03

 GO Function (1)

Protein-protein Interaction (4)

Gene RIF (7)

AA Sequence

MRSCFCVRRSRDPPPPQPPPPPPQRGTDQSTMPEVKDLSEALPETSMDPITGVGVVASRNRAPTGYDVVA      1 - 70
QTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENSHLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVA     71 - 140
FRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTTPSQSS    141 - 210
AASTPAPNLPRHISLTLPATFRGRNSTRTDYEYQHSNLYAISAMDGVPFMISEKFSCVPESMQPFDLLGI    211 - 280
TIKSLAEIEKEYEYSFRTEQSAAARLPPSPTRCQQIPQS                                   281 - 319
//

Text Mined References (18)

PMID Year Title