Property Summary

NCBI Gene PubMed Count 17
Grant Count 106
R01 Count 37
Funding $31,365,505.85
PubMed Score 683.70
PubTator Score 88.86

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8
Symbols B7H5
GI24
B7-H5
PD-1H
SISP1
VISTA
PP2135
C10orf54
DD1alpha

Gene

Gene RIF (3)

PMID Text
26228159 p53-induced expression of DD1alpha prevents persistence of cell corpses and ensures efficient generation of precise immune responses in mice.
25279955 overexpression of the newly described co-stimulatory molecule, PD1 homologue (PD-1H) in human monocyte/macrophages is sufficient to induce spontaneous secretion of multiple cytokines.
20666777 Results suggest that GI24 contributes to tumor-invasive growth in the collagen matrix by augmenting cell surface MT1-MMP.

AA Sequence

MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYK      1 - 70
TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLD     71 - 140
SGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPL    141 - 210
ILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLS    211 - 280
EPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI                                           281 - 311
//

Text Mined References (23)

PMID Year Title
26228159 2015 Control of signaling-mediated clearance of apoptotic cells by the tumor suppressor p53.
25279955 2014 Characterization of programmed death-1 homologue-1 (PD-1H) expression and function in normal and HIV infected individuals.
24691993 2014 VISTA is an immune checkpoint molecule for human T cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22488247 2012 Evolution of the B7 family: co-evolution of B7H6 and NKp30, identification of a new B7 family member, B7H7, and of B7's historical relationship with the MHC.
22424883 2012 Genome-wide association study of lung function decline in adults with and without asthma.
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
20666777 2010 GI24 enhances tumor invasiveness by regulating cell surface membrane-type 1 matrix metalloproteinase.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...