Property Summary

NCBI Gene PubMed Count 17
PubMed Score 683.70
PubTator Score 88.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 7.49434259766531E-28
non-small cell lung cancer 2798 6.0714236710839E-19
ovarian cancer 8492 9.5501767650191E-15
lung adenocarcinoma 2714 2.64552442768405E-14
atypical teratoid/rhabdoid tumor 1095 6.24106882442541E-10
chronic lymphosyte leukemia 232 8.54793852682987E-10
medulloblastoma, large-cell 6234 9.49150452637952E-8
group 4 medulloblastoma 1875 5.47390291088068E-7
tuberculosis 1563 9.08497992559346E-7
osteosarcoma 7933 1.01589663390047E-5
ductal carcinoma in situ 1745 7.44854646064592E-4
primary pancreatic ductal adenocarcinoma 1271 0.00105107267943061
primitive neuroectodermal tumor 3031 0.00299562562465529
invasive ductal carcinoma 2950 0.00393720024133822
X-linked cerebral adrenoleukodystrophy 115 0.0474049832014743

Expression

Synonym

Accession Q9H7M9 A1L0X9 A4ZYV1 A8MVH5 Q6UXF3 Q8WUG3 Q8WYZ8
Symbols B7H5
GI24
B7-H5
PD-1H
SISP1
VISTA
PP2135
C10orf54
DD1alpha

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

Gene RIF (3)

PMID Text
26228159 p53-induced expression of DD1alpha prevents persistence of cell corpses and ensures efficient generation of precise immune responses in mice.
25279955 overexpression of the newly described co-stimulatory molecule, PD1 homologue (PD-1H) in human monocyte/macrophages is sufficient to induce spontaneous secretion of multiple cytokines.
20666777 Results suggest that GI24 contributes to tumor-invasive growth in the collagen matrix by augmenting cell surface MT1-MMP.

AA Sequence

MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYK      1 - 70
TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLD     71 - 140
SGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPL    141 - 210
ILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLS    211 - 280
EPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI                                           281 - 311
//

Text Mined References (23)

PMID Year Title
26228159 2015 Control of signaling-mediated clearance of apoptotic cells by the tumor suppressor p53.
25279955 2014 Characterization of programmed death-1 homologue-1 (PD-1H) expression and function in normal and HIV infected individuals.
24691993 2014 VISTA is an immune checkpoint molecule for human T cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22488247 2012 Evolution of the B7 family: co-evolution of B7H6 and NKp30, identification of a new B7 family member, B7H7, and of B7's historical relationship with the MHC.
22424883 2012 Genome-wide association study of lung function decline in adults with and without asthma.
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
20666777 2010 GI24 enhances tumor invasiveness by regulating cell surface membrane-type 1 matrix metalloproteinase.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...