Property Summary

NCBI Gene PubMed Count 17
Grant Count 5
R01 Count 5
Funding $306,476
PubMed Score 33.37
PubTator Score 14.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -3.715 0.000
ovarian cancer 2.300 0.000
chronic rhinosinusitis -1.021 0.021

 GWAS Trait (1)

Gene RIF (4)

PMID Text
22984288 studies reveal that loss of FAM60A or another component of the Sin3 complex, SDS3, leads to a change in cell morphology and an increase in cell migration
22662218 Our results have demonstrated that these hyaluronan binding motifs (HABMs) in USP17 and its substrate SDS3 are mainly involved in the inhibition of anchorage-independent tumor growth.
21239494 SDS3, being a substrate of USP17, may play an important role in developing a novel therapeutic means to inhibit specific HDAC activities in cancer.
19070953 the composition of SIN3-HDAC (BRMS1/SUDS3) complexes uniquely affects protein expression and biological behaviors

AA Sequence

MSAAGLLAPAPAQAGAPPAPEYYPEEDEELESAEDDERSCRGRESDEDTEDASETDLAKHDEEDYVEMKE      1 - 70
QMYQDKLASLKRQLQQLQEGTLQEYQKRMKKLDQQYKERIRNAELFLQLETEQVERNYIKEKKAAVKEFE     71 - 140
DKKVELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPIMTRKLRRRPNDPVPIPDKRRKPAPAQLNYL    141 - 210
LTDEQIMEDLRTLNKLKSPKRPASPSSPEHLPATPAESPAQRFEARIEDGKLYYDKRWYHKSQAIYLESK    211 - 280
DNQKLSCVISSVGANEIWVRKTSDSTKMRIYLGQLQRGLFVIRRRSAA                          281 - 328
//

Text Mined References (27)

PMID Year Title
25805136 2015 FOXKs promote Wnt/?-catenin signaling by translocating DVL into the nucleus.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24909733 2014 TAOK3, a novel genome-wide association study locus associated with morphine requirement and postoperative pain in a retrospective pediatric day surgery population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22984288 2012 Human family with sequence similarity 60 member A (FAM60A) protein: a new subunit of the Sin3 deacetylase complex.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
22783022 2012 The Sin3a repressor complex is a master regulator of STAT transcriptional activity.
22662218 2012 Hyaluronan binding motifs of USP17 and SDS3 exhibit anti-tumor activity.
More...