Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.20
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
lung cancer 4,466
ovarian cancer 8,484

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer -1.100 0.037
ovarian cancer 1.500 0.000

Gene RIF (1)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAPKLITVLCLGFCLNQKICPHAGAQDKFSLSAWPSPVVPLGGRVTLSCHSHLRFVIWTIFQTTGTRSHE      1 - 70
LHTGLSNNITISPVTPEHAGTYRCVGIYKHASKWSAESNSLKIIVTGLFTKPSISAHPSSLVHAGARVSL     71 - 140
RCHSELAFDEFILYKEGHIQHSQQLDQGMEAGIHYVEAVFSMGPVTPAHAGAYRCCGCFSHSRYEWSAPS    141 - 210
DPLDIVITGKYKKPSLSTQVDPMMRLGEKLTLFCSSEISFDQYHLFRHGVAHGQWLSGGQRHREAFQANF    211 - 280
SVGRATPVPGGTYRCYGSFNDSPYKPPVTRCNFTPQETLRVLLCHSQNPPLNLTHLALKDSPATCICSLD    281 - 350
SQ                                                                        351 - 352
//

Text Mined References (6)

PMID Year Title
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16911775 2006 Identification of the ancestral killer immunoglobulin-like receptor gene in primates.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11441184 2001 Human chromosome 19 and related regions in mouse: conservative and lineage-specific evolution.