Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.10
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 4.14002162617833E-12
pilocytic astrocytoma 3086 2.88285842467443E-9
pediatric high grade glioma 2712 1.02949912775705E-7
Pick disease 1893 4.57727786530314E-7
atypical teratoid / rhabdoid tumor 4369 9.63889177722971E-7
glioblastoma 5572 9.92087870793065E-7
medulloblastoma, large-cell 6234 1.37601894094911E-4
tuberculosis 1563 2.24814416469411E-4
medulloblastoma 1524 0.00238260673293331
primitive neuroectodermal tumor 3031 0.00419338479436676
astrocytic glioma 2241 0.00614609212043204
progressive supranuclear palsy 674 0.00620454633620623
oligodendroglioma 2849 0.00748577322963159
ependymoma 2514 0.00930706087890156
subependymal giant cell astrocytoma 2287 0.0109288803448155
spina bifida 1064 0.0407734452079813

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.200 0.006
ependymoma -1.600 0.009
oligodendroglioma 1.400 0.007
osteosarcoma -3.199 0.000
glioblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma -1.200 0.002
medulloblastoma, large-cell -1.500 0.000
primitive neuroectodermal tumor -1.100 0.004
tuberculosis 1.200 0.000
pediatric high grade glioma -1.600 0.000
pilocytic astrocytoma -1.200 0.000
subependymal giant cell astrocytoma -1.071 0.011
spina bifida -1.634 0.041
Pick disease -1.900 0.000
progressive supranuclear palsy -1.300 0.006

Synonym

Accession Q9H7J1 D3DS47
Symbols

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRERPPGTDIPRNLSFIAALTERAYYRSQRPSLEEEPEEEPGEGGTRFGARSRAHAPSRGRRARSAPAG      1 - 70
GGGARAPRSRSPDTRKRVRFADALGLELAVVRRFRPGELPRVPRHVQIQLQRDALRHFAPCQPRARGLQE     71 - 140
ARAALEPASEPGFAARLLTQRICLERAEAGPLGVAGSARVVDLAYEKRVSVRWSADGWRSQREAPAAYAG    141 - 210
PAPPPPRADRFAFRLPAPPIGGALLFALRYRVTGHEFWDNNGGRDYALRGPEHPGSGGAPEPQGWIHFI     211 - 279
//

Text Mined References (7)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
15752363 2005 A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11948623 2002 Regulator-driven functional diversification of protein phosphatase-1 in eukaryotic evolution.