Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.10
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.100 2.1e-04
astrocytic glioma -1.200 6.1e-03
Astrocytoma, Pilocytic -1.200 6.5e-09
atypical teratoid / rhabdoid tumor -1.600 9.6e-07
ependymoma -1.600 9.3e-03
glioblastoma -1.100 4.3e-06
medulloblastoma -1.200 2.4e-03
medulloblastoma, large-cell -1.500 1.4e-04
oligodendroglioma 1.400 7.5e-03
osteosarcoma -2.164 9.6e-06
Pick disease -1.400 8.7e-07
primitive neuroectodermal tumor -1.100 4.2e-03
progressive supranuclear palsy -1.100 9.1e-03
spina bifida -1.634 4.1e-02
subependymal giant cell astrocytoma -1.071 1.1e-02
tuberculosis 1.200 2.2e-04

Gene RIF (1)

AA Sequence

MSRERPPGTDIPRNLSFIAALTERAYYRSQRPSLEEEPEEEPGEGGTRFGARSRAHAPSRGRRARSAPAG      1 - 70
GGGARAPRSRSPDTRKRVRFADALGLELAVVRRFRPGELPRVPRHVQIQLQRDALRHFAPCQPRARGLQE     71 - 140
ARAALEPASEPGFAARLLTQRICLERAEAGPLGVAGSARVVDLAYEKRVSVRWSADGWRSQREAPAAYAG    141 - 210
PAPPPPRADRFAFRLPAPPIGGALLFALRYRVTGHEFWDNNGGRDYALRGPEHPGSGGAPEPQGWIHFI     211 - 279
//

Text Mined References (7)

PMID Year Title