Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.10
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.200 0.006
ependymoma -1.600 0.009
oligodendroglioma 1.400 0.007
osteosarcoma -3.199 0.000
glioblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma -1.200 0.002
medulloblastoma, large-cell -1.500 0.000
primitive neuroectodermal tumor -1.100 0.004
tuberculosis 1.200 0.000
pediatric high grade glioma -1.600 0.000
pilocytic astrocytoma -1.200 0.000
subependymal giant cell astrocytoma -1.071 0.011
spina bifida -1.634 0.041
Pick disease -1.900 0.000
progressive supranuclear palsy -1.300 0.006

Gene RIF (1)

PMID Text
19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRERPPGTDIPRNLSFIAALTERAYYRSQRPSLEEEPEEEPGEGGTRFGARSRAHAPSRGRRARSAPAG      1 - 70
GGGARAPRSRSPDTRKRVRFADALGLELAVVRRFRPGELPRVPRHVQIQLQRDALRHFAPCQPRARGLQE     71 - 140
ARAALEPASEPGFAARLLTQRICLERAEAGPLGVAGSARVVDLAYEKRVSVRWSADGWRSQREAPAAYAG    141 - 210
PAPPPPRADRFAFRLPAPPIGGALLFALRYRVTGHEFWDNNGGRDYALRGPEHPGSGGAPEPQGWIHFI     211 - 279
//

Text Mined References (7)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
15752363 2005 A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11948623 2002 Regulator-driven functional diversification of protein phosphatase-1 in eukaryotic evolution.