Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.92
PubTator Score 0.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.8e-03
intraductal papillary-mucinous adenoma (... 1.100 5.2e-04
intraductal papillary-mucinous neoplasm ... 1.200 3.8e-03
osteosarcoma 1.275 3.4e-07
ovarian cancer -1.100 1.9e-05
Pick disease -1.400 1.4e-06
progressive supranuclear palsy -1.200 4.0e-03

Gene RIF (4)

AA Sequence

MAAALKCLLTLGRWCPGLGVAPQARALAALVPGVTQVDNKSGFLQKRPHRQHPGILKLPHVRLPQALANG      1 - 70
AQLLLLGSAGPTMENQVQTLTSYLWSRHLPVEPEELQRRARHLEKKFLENPDLSQTEEKLRGAVLHALRK     71 - 140
TTYHWQELSYTEGLSLVYMAARLDGGFAAVSRAFHEIRARNPAFQPQTLMDFGSGTGSVTWAAHSIWGQS    141 - 210
LREYMCVDRSAAMLVLAEKLLKGGSESGEPYIPGVFFRQFLPVSPKVQFDVVVSAFSLSELPSKADRTEV    211 - 280
VQTLWRKTGHFLVLVENGTKAGHSLLMDARDLVLKGKEKSPLDPRPGFVFAPCPHELPCPQLTNLACSFS    281 - 350
QAYHPIPFSWNKKPKEEKFSMVILARGSPEEAHRWPRITQPVLKRPRHVHCHLCCPDGHMQHAVLTARRH    351 - 420
GRDLYRCARVSSWGDLLPVLTPSAFPPSTAQDPSES                                      421 - 456
//

Text Mined References (14)

PMID Year Title