Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.92
PubTator Score 0.70

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
Pick disease 1893 3.47221216848181E-7
osteosarcoma 7933 6.2264408622204E-6
ovarian cancer 8492 1.87692545008199E-5
group 3 medulloblastoma 2254 3.93937247785323E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 5.18669117684339E-4
progressive supranuclear palsy 674 0.00278312433636292
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00380092188498746


  Differential Expression (7)


Accession Q9H7H0 Q9BSH1 Q9BZH2 Q9BZH3
Symbols METT11D1


  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid

Gene RIF (4)

26488768 METTL17 is a novel coactivator of estrogen receptors and may play a role in breast tumorigenesis.
24137763 METT11D1 mutations could not explain phenotype of patients with combined oxidative phosphorylation system deficiencies.
20877624 Observational study of gene-disease association. (HuGE Navigator)
11278769 Possible component of the small subunit of the mitochondrial ribosome, has similarity to yeast Rsm22 (Ykl155c) mitochondrial ribosomal protein.

AA Sequence

GRDLYRCARVSSWGDLLPVLTPSAFPPSTAQDPSES                                      421 - 456

Text Mined References (14)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26488768 2015 Methyltransferase-like 17 physically and functionally interacts with estrogen receptors.
25416956 2014 A proteome-scale map of the human interactome network.
24137763 2010 Sequence variants in four candidate genes (NIPSNAP1, GBAS, CHCHD1 and METT11D1) in patients with combined oxidative phosphorylation system deficiencies.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.