Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.92
PubTator Score 0.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession Q9H7H0 Q9BSH1 Q9BZH2 Q9BZH3
Symbols METT11D1

Gene

Gene RIF (4)

PMID Text
26488768 METTL17 is a novel coactivator of estrogen receptors and may play a role in breast tumorigenesis.
24137763 METT11D1 mutations could not explain phenotype of patients with combined oxidative phosphorylation system deficiencies.
20877624 Observational study of gene-disease association. (HuGE Navigator)
11278769 Possible component of the small subunit of the mitochondrial ribosome, has similarity to yeast Rsm22 (Ykl155c) mitochondrial ribosomal protein.

AA Sequence

MAAALKCLLTLGRWCPGLGVAPQARALAALVPGVTQVDNKSGFLQKRPHRQHPGILKLPHVRLPQALANG      1 - 70
AQLLLLGSAGPTMENQVQTLTSYLWSRHLPVEPEELQRRARHLEKKFLENPDLSQTEEKLRGAVLHALRK     71 - 140
TTYHWQELSYTEGLSLVYMAARLDGGFAAVSRAFHEIRARNPAFQPQTLMDFGSGTGSVTWAAHSIWGQS    141 - 210
LREYMCVDRSAAMLVLAEKLLKGGSESGEPYIPGVFFRQFLPVSPKVQFDVVVSAFSLSELPSKADRTEV    211 - 280
VQTLWRKTGHFLVLVENGTKAGHSLLMDARDLVLKGKEKSPLDPRPGFVFAPCPHELPCPQLTNLACSFS    281 - 350
QAYHPIPFSWNKKPKEEKFSMVILARGSPEEAHRWPRITQPVLKRPRHVHCHLCCPDGHMQHAVLTARRH    351 - 420
GRDLYRCARVSSWGDLLPVLTPSAFPPSTAQDPSES                                      421 - 456
//

Text Mined References (14)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26488768 2015 Methyltransferase-like 17 physically and functionally interacts with estrogen receptors.
25416956 2014 A proteome-scale map of the human interactome network.
24137763 2010 Sequence variants in four candidate genes (NIPSNAP1, GBAS, CHCHD1 and METT11D1) in patients with combined oxidative phosphorylation system deficiencies.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...