Property Summary

NCBI Gene PubMed Count 20
PubMed Score 7.95
PubTator Score 4.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Menopause present (finding) 20
Disease Target Count P-value
ovarian cancer 8492 2.24341638262697E-9
group 3 medulloblastoma 2254 1.69854875284431E-5
psoriasis 6685 2.20774466991116E-5
lung cancer 4473 0.00534947672051241
osteosarcoma 7933 0.0123615322859049
Disease Target Count Z-score Confidence
Asbestosis 10 3.593 1.8
Sertoli cell-only syndrome 36 3.59 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -3.000 0.000
osteosarcoma -1.174 0.012
group 3 medulloblastoma 2.000 0.000
lung cancer -1.100 0.005
ovarian cancer -1.300 0.000

Synonym

Accession Q9H7E2 B2MWP9 Q53XA6 Q6P992
Symbols

Gene

PDB

2LTO   1WJI   3PMT   3PNW   3S6W  

  Ortholog (13)

Gene RIF (4)

PMID Text
22363433 The binding specificity and affinity of the Tudor domains of TDRD3, SMN and SPF30 proteins were characterized quantitatively.
21172665 The TDRD3 is an effector molecule that promotes transcription by binding methylarginine marks on histone tails.
18664458 propose a contribution of Tdrd3 to FMRP-mediated translational repression and suggest that the loss of the FMRP-Tdrd3 interaction caused by the I304N mutation might contribute to the pathogenesis of Fragile X syndrome
18632687 Tudor domain of TDRD3 was required for its recruitment to cytoplasmic stress granules.

AA Sequence

MLRLQMTDGHISCTAVEFSYMSKISLNTPPGTKVKLSGIVDIKNGFLLLNDSNTTVLGGEVEHLIEKWEL      1 - 70
QRSLSKHNRSNIGTEGGPPPFVPFGQKCVSHVQVDSRELDRRKTLQVTMPVKPTNDNDEFEKQRTAAIAE     71 - 140
VAKSKETKTFGGGGGGARSNLNMNAAGNRNREVLQKEKSTKSEGKHEGVYRELVDEKALKHITEMGFSKE    141 - 210
ASRQALMDNGNNLEAALNVLLTSNKQKPVMGPPLRGRGKGRGRIRSEDEEDLGNARPSAPSTLFDFLESK    211 - 280
MGTLNVEEPKSQPQQLHQGQYRSSNTEQNGVKDNNHLRHPPRNDTRQPRNEKPPRFQRDSQNSKSVLEGS    281 - 350
GLPRNRGSERPSTSSVSEVWAEDRIKCDRPYSRYDRTKDTSYPLGSQHSDGAFKKRDNSMQSRSGKGPSF    351 - 420
AEAKENPLPQGSVDYNNQKRGKRESQTSIPDYFYDRKSQTINNEAFSGIKIEKHFNVNTDYQNPVRSNSF    421 - 490
IGVPNGEVEMPLKGRRIGPIKPAGPVTAVPCDDKIFYNSGPKRRSGPIKPEKILESSIPMEYAKMWKPGD    491 - 560
ECFALYWEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEVLLSNIKPIQTEAWEEEGTYDQTLEFRRGGD    561 - 630
GQPRRSTRPTQQFYQPPRARN                                                     631 - 651
//

Text Mined References (26)

PMID Year Title
26700805 2016 SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22363433 2012 Crystal structure of TDRD3 and methyl-arginine binding characterization of TDRD3, SMN and SPF30.
22267201 2012 Meta-analyses identify 13 loci associated with age at menopause and highlight DNA repair and immune pathways.
21172665 2010 TDRD3 is an effector molecule for arginine-methylated histone marks.
20930030 2010 SMG6 interacts with the exon junction complex via two conserved EJC-binding motifs (EBMs) required for nonsense-mediated mRNA decay.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...