Property Summary

NCBI Gene PubMed Count 21
PubMed Score 10.01
PubTator Score 4.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 2.2e-09
group 3 medulloblastoma 4104 7.7e-06
psoriasis 6694 2.2e-05
lung cancer 4740 5.3e-03
osteosarcoma 7950 1.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Asbestosis 20 3.451 1.7
Sertoli cell-only syndrome 37 3.439 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.500 7.7e-06
lung cancer -1.100 5.3e-03
osteosarcoma -1.174 1.2e-02
ovarian cancer -1.300 2.2e-09
psoriasis -3.000 2.2e-05

Gene RIF (5)

AA Sequence

MLRLQMTDGHISCTAVEFSYMSKISLNTPPGTKVKLSGIVDIKNGFLLLNDSNTTVLGGEVEHLIEKWEL      1 - 70
QRSLSKHNRSNIGTEGGPPPFVPFGQKCVSHVQVDSRELDRRKTLQVTMPVKPTNDNDEFEKQRTAAIAE     71 - 140
VAKSKETKTFGGGGGGARSNLNMNAAGNRNREVLQKEKSTKSEGKHEGVYRELVDEKALKHITEMGFSKE    141 - 210
ASRQALMDNGNNLEAALNVLLTSNKQKPVMGPPLRGRGKGRGRIRSEDEEDLGNARPSAPSTLFDFLESK    211 - 280
MGTLNVEEPKSQPQQLHQGQYRSSNTEQNGVKDNNHLRHPPRNDTRQPRNEKPPRFQRDSQNSKSVLEGS    281 - 350
GLPRNRGSERPSTSSVSEVWAEDRIKCDRPYSRYDRTKDTSYPLGSQHSDGAFKKRDNSMQSRSGKGPSF    351 - 420
AEAKENPLPQGSVDYNNQKRGKRESQTSIPDYFYDRKSQTINNEAFSGIKIEKHFNVNTDYQNPVRSNSF    421 - 490
IGVPNGEVEMPLKGRRIGPIKPAGPVTAVPCDDKIFYNSGPKRRSGPIKPEKILESSIPMEYAKMWKPGD    491 - 560
ECFALYWEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEVLLSNIKPIQTEAWEEEGTYDQTLEFRRGGD    561 - 630
GQPRRSTRPTQQFYQPPRARN                                                     631 - 651
//

Text Mined References (28)

PMID Year Title