Property Summary

NCBI Gene PubMed Count 29
PubMed Score 13.88
PubTator Score 8.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
esophageal adenocarcinoma -1.300 2.7e-02
glioblastoma 1.100 1.9e-02
intraductal papillary-mucinous carcinoma... 1.300 1.6e-03
Multiple myeloma 1.366 2.6e-03
ovarian cancer -1.600 1.5e-05
Pick disease -1.300 2.6e-05
progressive supranuclear palsy -1.100 1.5e-02
spina bifida -1.098 4.3e-02
subependymal giant cell astrocytoma 1.283 2.4e-02

Gene RIF (10)

AA Sequence

MQANGAGGGGGGGGGGGGGGGGGGGQGQTPELACLSAQNGESSPSSSSSAGDLAHANGLLPSAPSAASNN      1 - 70
SNSLNVNNGVPGGAAAASSATVAAASATTAASSSLATPELGSSLKKKKRLSQSDEDVIRLIGQHLNGLGL     71 - 140
NQTVDLLMQESGCRLEHPSATKFRNHVMEGDWDKAENDLNELKPLVHSPHAIVVRGALEISQTLLGIIVR    141 - 210
MKFLLLQQKYLEYLEDGKVLEALQVLRCELTPLKYNTERIHVLSGYLMCSHAEDLRAKAEWEGKGTASRS    211 - 280
KLLDKLQTYLPPSVMLPPRRLQTLLRQAVELQRDRCLYHNTKLDNNLDSVSLLIDHVCSRRQFPCYTQQI    281 - 350
LTEHCNEVWFCKFSNDGTKLATGSKDTTVIIWQVDPDTHLLKLLKTLEGHAYGVSYIAWSPDDNYLVACG    351 - 420
PDDCSELWLWNVQTGELRTKMSQSHEDSLTSVAWNPDGKRFVTGGQRGQFYQCDLDGNLLDSWEGVRVQC    421 - 490
LWCLSDGKTVLASDTHQRIRGYNFEDLTDRNIVQEDHPIMSFTISKNGRLALLNVATQGVHLWDLQDRVL    491 - 560
VRKYQGVTQGFYTIHSCFGGHNEDFIASGSEDHKVYIWHKRSELPIAELTGHTRTVNCVSWNPQIPSMMA    561 - 630
SASDDGTVRIWGPAPFIDHQNIEEECSSMDS                                           631 - 661
//

Text Mined References (36)

PMID Year Title