Property Summary

NCBI Gene PubMed Count 25
Grant Count 276
R01 Count 171
Funding $29,365,013.14
PubMed Score 11.27
PubTator Score 8.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.366 0.003
esophageal adenocarcinoma -1.300 0.027
glioblastoma 1.100 0.019
intraductal papillary-mucinous carcinoma... 1.300 0.002
subependymal giant cell astrocytoma 1.283 0.024
spina bifida -1.098 0.043
Pick disease -1.300 0.000
progressive supranuclear palsy -1.100 0.015
ovarian cancer 2.300 0.000

Synonym

Accession Q9H7D7 A0MNN3 Q4G100 Q59EC4 Q5GLZ9 Q86UY4 Q9H3C2
Symbols CDW2
GID7
MIP2

Gene

Gene RIF (6)

PMID Text
25918994 The WDR26 gene was differentially methylated in monozygotic twins discordant for depressive disorder.
23625927 WDR26 functions as a scaffolding protein to promote PLCbeta2 membrane translocation and interaction with Gbetagamma, thereby enhancing PLCbeta2 activation in leukocytes.
22065575 WDR26 is a novel Gbetagamma-binding protein that is required for the efficacy of Gbetagamma signaling and leukocyte migration
20171191 these data suggest that MIP2 may participate in the progression of cell proliferation in H9c2 cells.
19446606 The results of this study indicated that WDR26 was up-regulated by oxidative stress and played a key role in H2O2-induced SH-SY5Y cell death, which may be mediated by the down-regulation of AP-1 transcriptional activity.
15378603 WDR26 may act as a negative regulator in MAPK signaling pathway and play an important role in cell signal transduction.

AA Sequence

MQANGAGGGGGGGGGGGGGGGGGGGQGQTPELACLSAQNGESSPSSSSSAGDLAHANGLLPSAPSAASNN      1 - 70
SNSLNVNNGVPGGAAAASSATVAAASATTAASSSLATPELGSSLKKKKRLSQSDEDVIRLIGQHLNGLGL     71 - 140
NQTVDLLMQESGCRLEHPSATKFRNHVMEGDWDKAENDLNELKPLVHSPHAIVVRGALEISQTLLGIIVR    141 - 210
MKFLLLQQKYLEYLEDGKVLEALQVLRCELTPLKYNTERIHVLSGYLMCSHAEDLRAKAEWEGKGTASRS    211 - 280
KLLDKLQTYLPPSVMLPPRRLQTLLRQAVELQRDRCLYHNTKLDNNLDSVSLLIDHVCSRRQFPCYTQQI    281 - 350
LTEHCNEVWFCKFSNDGTKLATGSKDTTVIIWQVDPDTHLLKLLKTLEGHAYGVSYIAWSPDDNYLVACG    351 - 420
PDDCSELWLWNVQTGELRTKMSQSHEDSLTSVAWNPDGKRFVTGGQRGQFYQCDLDGNLLDSWEGVRVQC    421 - 490
LWCLSDGKTVLASDTHQRIRGYNFEDLTDRNIVQEDHPIMSFTISKNGRLALLNVATQGVHLWDLQDRVL    491 - 560
VRKYQGVTQGFYTIHSCFGGHNEDFIASGSEDHKVYIWHKRSELPIAELTGHTRTVNCVSWNPQIPSMMA    561 - 630
SASDDGTVRIWGPAPFIDHQNIEEECSSMDS                                           631 - 661
//

Text Mined References (32)

PMID Year Title
27098453 2016 WDR26 is a new partner of Axin1 in the canonical Wnt signaling pathway.
25918994 2015 Genome-wide methylation study on depression: differential methylation and variable methylation in monozygotic twins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23625927 2013 WDR26 functions as a scaffolding protein to promote G??-mediated phospholipase C ?2 (PLC?2) activation in leukocytes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22065575 2011 The WD40 repeat protein WDR26 binds G?? and promotes G??-dependent signal transduction and leukocyte migration.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21042317 2012 Genome-wide association study of major depressive disorder: new results, meta-analysis, and lessons learned.
20171191 2010 Overexpression of MIP2, a novel WD-repeat protein, promotes proliferation of H9c2 cells.
More...