Property Summary

NCBI Gene PubMed Count 8
Grant Count 1
Funding $70,654.6
PubMed Score 24.12
PubTator Score 12.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -2.100 0.000
psoriasis -1.200 0.000
glioblastoma multiforme 1.100 0.000
posterior fossa group B ependymoma 3.000 0.000
non-small cell lung cancer -1.880 0.000
active Crohn's disease -1.536 0.050
ulcerative colitis -1.400 0.001
interstitial cystitis 1.100 0.003
lung adenocarcinoma -1.200 0.000
invasive ductal carcinoma -1.200 0.020
ovarian cancer -2.500 0.000
head and neck cancer -1.700 0.014

Synonym

Accession Q9H7C4 B4DNK8 B4DY58 C9IY41
Symbols SYNC1
SYNCOILIN

Gene

 Grant Application (1)

Gene RIF (3)

PMID Text
20587592 Syncoilin modulates peripherin filament network formation.
20199207 The differences in human syncoilin and beta-synemin mRNA ratios between Duchenne muscular dystrophy and normal muscles were not statistically significant
16124004 the result of this study raise the possibility that mutations in the gene encoding for syncoilin may underlie some forms of muscle disease.

AA Sequence

MASPEPRRGGDGAAQAARKTRVEANSPLPKNSGSLNEAEALNPEVTLSSEGSLNLEDILYLEDTGDLDET      1 - 70
LYVQETEKAEEALYIEEAMQPDEALHVEEPGNPEETVCVEETTEPDRIQFVEGPVEPGKPTSPEHVVYEG     71 - 140
ETVTRAEKSNPEESLRAEQSPSMEENLSIEDLELLEGRFQQCVQAVAQLEEERDQLIHELVLLREPALQE    141 - 210
VQQVHQDILAAYKLHAQAELERDGLREEIRLVKQKLFKVTKECVAYQYQLECRQQDVAQFADFREVLTTR    211 - 280
ATQLSEELAQLRDAYQKQKEQLRQQLEAPPSQRDGHFLQESRRLSAQFENLMAESRQDLEEEYEPQFLRL    281 - 350
LERKEAGTKALQRTQAEIQEMKEALRPLQAEARQLRLQNRNLEDQIALVRQKRDEEVQQYREQLEEMEER    351 - 420
QRQLRNGVQLQQQKNKEMEQLRLSLAEELSTYKAMLLPKSLEQADAPTSQAGGMETQSQGAV            421 - 482
//

Text Mined References (13)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20587592 2010 Syncoilin modulates peripherin filament networks and is necessary for large-calibre motor neurons.
20199207 2010 Dysbindin, syncoilin, and beta-synemin mRNA levels in dystrophic muscles.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16429158 2006 Disrupted function and axonal distribution of mutant tyrosyl-tRNA synthetase in dominant intermediate Charcot-Marie-Tooth neuropathy.
16124004 2005 Syncoilin upregulation in muscle of patients with neuromuscular disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...