Property Summary

NCBI Gene PubMed Count 8
PubMed Score 24.27
PubTator Score 12.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (12)

Disease log2 FC p
active Crohn's disease -1.536 5.0e-02
active ulcerative colitis -1.285 2.0e-02
ependymoma 2.700 1.2e-14
glioblastoma multiforme 1.100 2.0e-08
head and neck cancer -1.700 1.4e-02
interstitial cystitis 1.100 2.8e-03
invasive ductal carcinoma -1.200 2.0e-02
lung adenocarcinoma -1.200 7.4e-08
malignant mesothelioma -2.100 4.9e-08
non-small cell lung cancer -1.880 4.0e-22
ovarian cancer -2.500 6.3e-13
psoriasis -1.200 1.1e-07

Gene RIF (3)

AA Sequence

MASPEPRRGGDGAAQAARKTRVEANSPLPKNSGSLNEAEALNPEVTLSSEGSLNLEDILYLEDTGDLDET      1 - 70
LYVQETEKAEEALYIEEAMQPDEALHVEEPGNPEETVCVEETTEPDRIQFVEGPVEPGKPTSPEHVVYEG     71 - 140
ETVTRAEKSNPEESLRAEQSPSMEENLSIEDLELLEGRFQQCVQAVAQLEEERDQLIHELVLLREPALQE    141 - 210
VQQVHQDILAAYKLHAQAELERDGLREEIRLVKQKLFKVTKECVAYQYQLECRQQDVAQFADFREVLTTR    211 - 280
ATQLSEELAQLRDAYQKQKEQLRQQLEAPPSQRDGHFLQESRRLSAQFENLMAESRQDLEEEYEPQFLRL    281 - 350
LERKEAGTKALQRTQAEIQEMKEALRPLQAEARQLRLQNRNLEDQIALVRQKRDEEVQQYREQLEEMEER    351 - 420
QRQLRNGVQLQQQKNKEMEQLRLSLAEELSTYKAMLLPKSLEQADAPTSQAGGMETQSQGAV            421 - 482
//

Text Mined References (13)

PMID Year Title