Property Summary

Ligand Count 19
NCBI Gene PubMed Count 63
PubMed Score 77.93
PubTator Score 55.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Amphetamine-Related Disorders 74 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Brain cancer 30 0.0 0.8
Malignant glioma 26 0.0 0.8
Disease Target Count Z-score Confidence
Cancer 2499 3.61 1.8

Expression

  Differential Expression (8)

Disease log2 FC p
ductal carcinoma in situ 1.600 1.1e-02
group 3 medulloblastoma 1.100 1.2e-02
intraductal papillary-mucinous adenoma (... 1.100 2.9e-02
invasive ductal carcinoma 1.018 3.2e-03
lung cancer 1.600 9.2e-04
malignant mesothelioma -2.700 3.1e-08
ovarian cancer 2.300 9.6e-05
tuberculosis 1.100 2.9e-06

 MGI Phenotype (1)

Protein-protein Interaction (6)

Gene RIF (53)

AA Sequence

MEPLKVEKFATAKRGNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLMRCSQCRVAKY      1 - 70
CSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDK     71 - 140
KEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVICNSFTICNAEMQEVGVGLYPSISLLNHSCDP    141 - 210
NCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEERRKQLRDQYCFECDCFRCQTQDKDADMLTGDE    211 - 280
QVWKEVQESLKKIEELKAHWKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFY    281 - 350
GTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEE    351 - 420
CDANIRAS                                                                  421 - 428
//

Text Mined References (66)

PMID Year Title