Property Summary

NCBI Gene PubMed Count 55
Grant Count 4
R01 Count 3
Funding $254,253.16
PubMed Score 70.54
PubTator Score 55.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -2.700 0.000
tuberculosis 1.100 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.029
lung cancer 1.600 0.001
group 3 medulloblastoma 1.100 0.012
invasive ductal carcinoma 1.500 0.000
ductal carcinoma in situ 1.600 0.011
ovarian cancer 2.300 0.000

Synonym

Accession Q9H7B4 A8K0P0 B1AN38 Q86TL8 Q8N5Z6 Q96AI5
Symbols KMT3E
ZMYND1
ZNFN3A1
bA74P14.1

Gene

PDB

5EX3   5EX0   5HQ8   3MEK   3OXF   3OXG   3OXL   3PDN   3QWP   3RU0   5CCL   5CCM   5HI7  

 GO Component (2)

Gene RIF (45)

PMID Text
27085704 Postulate that AdoMet cofactor acts like a key and locks Smyd3 in a closed conformation.
26929412 results clearly revealed structural determinants for the substrate preference of SMYD3 and provided mechanistic insights into lysine methylation of MAP3K2.
26616333 A novel HBx-interacting protein, SMYD3, was identified, leading to proposal of a novel mechanism of AP-1 activation in HBV-infected cells.
26350217 SMYD3 interacts with the human positive coactivator 4 (PC4) and that such interaction potentiates a group of genes whose expression is linked to cell proliferation and invasion.
26328527 Results showed that SMYD3 is overexpressed in human glioma and contributes to glioma tumorigenicity through p53.
26077602 SET and MYND domain-containing protein 3 expression and TGF-beta1 expression in gastric cancer (GC) tissues were significantly and positively correlated. High expression levels of SMYD3 and TGF-beta1 can indicate poor prognoses for GC patients.
25980436 Results support a proto-oncogenic role for SMYD3 in prostate carcinogenesis, mainly due to its methyltransferase enzymatic activity.
25738358 Loss of SMYD3-HSP90 interaction leads to SMYD3 mislocalization within the nucleus, thereby losing its chromatin association. This results in reduction of SMYD3-mediated cell proliferation and, potentially, impairment of SMYD3's oncogenic activity.
25728514 represent the proof of principle that SMYD3 is a druggable target
25627005 SMYD3 and MMP-9 may play important roles in tumor invasion, metastasis, and prognosis and could work as promising targets for prognostic prediction in gastric cancer.
More...

AA Sequence

MEPLKVEKFATAKRGNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLMRCSQCRVAKY      1 - 70
CSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDK     71 - 140
KEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVICNSFTICNAEMQEVGVGLYPSISLLNHSCDP    141 - 210
NCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEERRKQLRDQYCFECDCFRCQTQDKDADMLTGDE    211 - 280
QVWKEVQESLKKIEELKAHWKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFY    281 - 350
GTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEE    351 - 420
CDANIRAS                                                                  421 - 428
//

Text Mined References (58)

PMID Year Title
27085704 2016 Smyd3 open & closed lock mechanism for substrate recruitment: The hinge motion of C-terminal domain inferred from ?-second molecular dynamics simulations.
26929412 2016 Structural Basis for Substrate Preference of SMYD3, a SET Domain-containing Protein Lysine Methyltransferase.
26616333 2016 Interaction of the hepatitis B virus X protein with the lysine methyltransferase SET and MYND domain-containing 3 induces activator protein 1 activation.
26350217 2015 Cooperation between SMYD3 and PC4 drives a distinct transcriptional program in cancer cells.
26328527 2015 SET and MYND domain-containing protein 3 is overexpressed in human glioma and contributes to tumorigenicity.
26077602 2015 Elevated Levels of SET and MYND Domain-Containing Protein 3 Are Correlated with Overexpression of Transforming Growth Factor-?1 in Gastric Cancer.
25980436 2015 SMYD3 contributes to a more aggressive phenotype of prostate cancer and targets Cyclin D2 through H4K20me3.
25738358 2015 C-terminal domain of SMYD3 serves as a unique HSP90-regulated motif in oncogenesis.
25728514 2015 A SMYD3 Small-Molecule Inhibitor Impairing Cancer Cell Growth.
25627005 2015 Overexpression of SMYD3 and matrix metalloproteinase-9 are associated with poor prognosis of patients with gastric cancer.
More...