Property Summary

NCBI Gene PubMed Count 19
Grant Count 7
R01 Count 4
Funding $238,788.14
PubMed Score 33.62
PubTator Score 214.40

Knowledge Summary

Patent (2,693)

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -2.000 0.000
group 4 medulloblastoma -1.600 0.000
medulloblastoma, large-cell -1.200 0.000
primary pancreatic ductal adenocarcinoma 1.302 0.005
non-small cell lung cancer -1.484 0.000
lung cancer -1.100 0.000
lung adenocarcinoma -1.600 0.000
lung carcinoma -1.600 0.000
spina bifida 1.384 0.029
invasive ductal carcinoma -1.400 0.002
ovarian cancer -2.300 0.000
pancreatic cancer 1.100 0.009

Gene RIF (9)

PMID Text
26297948 this regard, we have demonstrated that PEAK1 is necessary for TGFbeta to induce ZEB1-mediated EMT in the context of fibronectin/ITGB3 activation.
26267863 report is the first to provide evidence that PEAK1 mediates signaling cross talk between TGFbeta receptors and integrin/Src/MAPK pathways and that PEAK1 is an important molecular regulator of TGFbeta-induced tumor progression and metastasis in breast cancer
25445115 Suggest that loss of PEAK1/E-cadherin may play an important role in carcinogenesis and development of gastric cancer through activating epithelial to mesenchymal transition.
25261239 eIF5A proteins utilize PEAK1 as a downstream effector to drive pancreatic ductal adenocarcinoma (PDAC) pathogenesis.
23378338 results define a novel signaling pathway in basal breast cancer involving Lyn and SgK269 that offers clinical opportunities for therapeutic intervention
23105102 phosphorylation of tyrosine 665 in pseudopodium-enriched atypical kinase 1 (PEAK1) is essential for the regulation of cell migration and focal adhesion turnover
22589274 Here, we report that the novel tyrosine kinase PEAK1 is upregulated in human malignancies, including human PDACs and pancreatic intraepithelial neoplasia (PanIN).
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12471243 Also known as SgK269. Contains a divergent and possibly inactive eukaryotic protein kinase domain. Has one human paralog, known as SgK223 or pragmin. These two constitute the NKF3 subfamily of protein kinases, found in vertebrates and echinoderms

AA Sequence

MSACNTFTEHVWKPGECKNCFKPKSLHQLPPDPEKAPITHGNVKTNANHSNNHRIRNTGNFRPPVAKKPT      1 - 70
IAVKPTMIVADGQSICGELSIQEHCENKPVIIGWNRNRAALSQKPLNNNNEDDEGISHVPKPYGNNDSAK     71 - 140
KMSDNNNGLTEVLKEIAGLDTAPQIRGNETNSRETFLGRINDCYKRSLERKLPPSCMIGGIKETQGKHVI    141 - 210
LSGSTEVISNEGGRFCYPEFSSGEESEEDVLFSNMEEEHESWDESDEELLAMEIRMRGQPRFANFRANTL    211 - 280
SPVRFFVDKKWNTIPLRNKSLQRICAVDYDDSYDEILNGYEENSVVSYGQGSIQSMVSSDSTSPDSSLTE    281 - 350
ESRSETASSLSQKICNGGLSPGNPGDSKDMKEIEPNYESPSSNNQDKDSSQASKSSIKVPETHKAVLALR    351 - 420
LEEKDGKIAVQTEKEESKASTDVAGQAVTINLVPTEEQAKPYRVVNLEQPLCKPYTVVDVSAAMASEHLE    421 - 490
GPVNSPKTKSSSSTPNSPVTSSSLTPGQISAHFQKSSAIRYQEVWTSSTSPRQKIPKVELITSGTGPNVP    491 - 560
PRKNCHKSAPTSPTATNISSKTIPVKSPNLSEIKFNSYNNAGMPPFPIIIHDEPTYARSSKNAIKVPIVI    561 - 630
NPNAYDNLAIYKSFLGTSGELSVKEKTTSVISHTYEEIETESKVPDNTTSKTTDCLQTKGFSNSTEHKRG    631 - 700
SVAQKVQEFNNCLNRGQSSPQRSYSSSHSSPAKIQRATQEPVAKIEGTQESQMVGSSSTREKASTVLSQI    701 - 770
VASIQPPQSPPETPQSGPKACSVEELYAIPPDADVAKSTPKSTPVRPKSLFTSQPSGEAEAPQTTDSPTT    771 - 840
KVQKDPSIKPVTPSPSKLVTSPQSEPPAPFPPPRSTSSPYHAGNLLQRHFTNWTKPTSPTRSTEAESVLH    841 - 910
SEGSRRAADAKPKRWISFKSFFRRRKTDEEDDKEKEREKGKLVGLDGTVIHMLPPPPVQRHHWFTEAKGE    911 - 980
SSEKPAIVFMYRCDPAQGQLSVDQSKARTDQAAVMEKGRAENALLQDSEKKRSHSSPSQIPKKILSHMTH    981 - 1050
EVTEDFSPRDPRTVVGKQDGRGCTSVTTALSLPELEREDGKEDISDPMDPNPCSATYSNLGQSRAAMIPP   1051 - 1120
KQPRQPKGAVDDAIAFGGKTDQEAPNASQPTPPPLPKKMIIRANTEPISKDLQKSMESSLCVMANPTYDI   1121 - 1190
DPNWDASSAGSSISYELKGLDIESYDSLERPLRKERPVPSAANSISSLTTLSIKDRFSNSMESLSSRRGP   1191 - 1260
SCRQGRGIQKPQRQALYRGLENREEVVGKIRSLHTDALKKLAVKCEDLFMAGQKDQLRFGVDSWSDFRLT   1261 - 1330
SDKPCCEAGDAVYYTASYAKDPLNNYAVKICKSKAKESQQYYHSLAVRQSLAVHFNIQQDCGHFLAEVPN   1331 - 1400
RLLPWEDPDDPEKDEDDMEETEEDAKGETDGKNPKPCSEAASSQKENQGVMSKKQRSHVVVITREVPCLT   1401 - 1470
VADFVRDSLAQHGKSPDLYERQVCLLLLQLCSGLEHLKPYHVTHCDLRLENLLLVHYQPGGTAQGFGPAE   1471 - 1540
PSPTSSYPTRLIVSNFSQAKQKSHLVDPEILRDQSRLAPEIITATQYKKCDEFQTGILIYEMLHLPNPFD   1541 - 1610
ENPELKEREYTRADLPRIPFRSPYSRGLQQLASCLLNPNPSERILISDAKGILQCLLWGPREDLFQTFTA   1611 - 1680
CPSLVQRNTLLQNWLDIKRTLLMIKFAEKSLDREGGISLEDWLCAQYLAFATTDSLSCIVKILQHR       1681 - 1746
//

Text Mined References (25)

PMID Year Title
26297948 2015 Identification of a PEAK1/ZEB1 signaling axis during TGF?/fibronectin-induced EMT in breast cancer.
26267863 2015 PEAK1 Acts as a Molecular Switch to Regulate Context-Dependent TGF? Responses in Breast Cancer.
25445115 2014 Analysis of a cytoskeleton-associated kinase PEAK1 and E-cadherin in gastric cancer.
25261239 2014 A hypusine-eIF5A-PEAK1 switch regulates the pathogenesis of pancreatic cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23378338 2013 Involvement of Lyn and the atypical kinase SgK269/PEAK1 in a basal breast cancer signaling pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23105102 2013 Dynamic phosphorylation of tyrosine 665 in pseudopodium-enriched atypical kinase 1 (PEAK1) is essential for the regulation of cell migration and focal adhesion turnover.
22589274 2012 KRas induces a Src/PEAK1/ErbB2 kinase amplification loop that drives metastatic growth and therapy resistance in pancreatic cancer.
21301050 2010 PEAK1, a novel kinase target in the fight against cancer.
More...