Property Summary

NCBI Gene PubMed Count 24
PubMed Score 7.79
PubTator Score 10.13

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
24315626 New evidence for SH2D4A involvement in hepatocellular carcinoma pathogenesis demonstrating for the first time its deregulation in cirrhotic nodules.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19712589 SH2D4A inhibited cell proliferation by suppression of the ERalpha/PLC-gamma/PKC signaling pathway.
18641339 SH2D4A is dispensable for TCR signal transduction in T cells

AA Sequence

MLKQILSEMYIDPDLLAELSEEQKQILFFKMREEQIRRWKEREAAMERKESLPVKPRPKKENGKSVHWKL      1 - 70
GADKEVWVWVMGEHHLDKPYDVLCNEIIAERARLKAEQEAEEPRKTHSEEFTNSLKTKSQYHDLQAPDNQ     71 - 140
QTKDIWKKVAEKEELEQGSRPAPTLEEEKIRSLSSSSRNIQQMLADSINRMKAYAFHQKKESMKKKQDEE    141 - 210
INQIEEERTKQICKSWKEDSEWQASLRKSKAADEKRRSLAKQAREDYKRLSLGAQKGRGGERLQSPLRVP    211 - 280
QKPERPPLPPKPQFLNSGAYPQKPLRNQGVVRTLSSSAQEDIIRWFKEEQLPLRAGYQKTSDTIAPWFHG    281 - 350
ILTLKKANELLLSTGMPGSFLIRVSERIKGYALSYLSEDGCKHFLIDASADAYSFLGVDQLQHATLADLV    351 - 420
EYHKEEPITSLGKELLLYPCGQQDQLPDYLELFE                                        421 - 454
//

Text Mined References (31)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24595857 2014 Genome-wide association study of urinary albumin excretion rate in patients with type 1 diabetes.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
24315626 2014 SH2D4A is frequently downregulated in hepatocellular carcinoma and cirrhotic nodules.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...