Property Summary

NCBI Gene PubMed Count 27
PubMed Score 7.79
PubTator Score 10.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (5)

AA Sequence

MLKQILSEMYIDPDLLAELSEEQKQILFFKMREEQIRRWKEREAAMERKESLPVKPRPKKENGKSVHWKL      1 - 70
GADKEVWVWVMGEHHLDKPYDVLCNEIIAERARLKAEQEAEEPRKTHSEEFTNSLKTKSQYHDLQAPDNQ     71 - 140
QTKDIWKKVAEKEELEQGSRPAPTLEEEKIRSLSSSSRNIQQMLADSINRMKAYAFHQKKESMKKKQDEE    141 - 210
INQIEEERTKQICKSWKEDSEWQASLRKSKAADEKRRSLAKQAREDYKRLSLGAQKGRGGERLQSPLRVP    211 - 280
QKPERPPLPPKPQFLNSGAYPQKPLRNQGVVRTLSSSAQEDIIRWFKEEQLPLRAGYQKTSDTIAPWFHG    281 - 350
ILTLKKANELLLSTGMPGSFLIRVSERIKGYALSYLSEDGCKHFLIDASADAYSFLGVDQLQHATLADLV    351 - 420
EYHKEEPITSLGKELLLYPCGQQDQLPDYLELFE                                        421 - 454
//

Text Mined References (34)

PMID Year Title