Property Summary

NCBI Gene PubMed Count 11
PubMed Score 96.74
PubTator Score 25.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -2.400 0.000
osteosarcoma -1.601 0.000
group 3 medulloblastoma 1.700 0.000
pilocytic astrocytoma 1.100 0.000
posterior fossa group B ependymoma 1.400 0.000
Breast cancer -1.200 0.000
pituitary cancer 1.300 0.000

Gene RIF (1)

PMID Text
18573253 Human tRNase ZS gene expression appears to be post-transcriptionally regulated.

AA Sequence

MSMDVTFLGTGAAYPSPTRGASAVVLRCEGECWLFDCGEGTQTQLMKSQLKAGRITKIFITHLHGDHFFG      1 - 70
LPGLLCTISLQSGSMVSKQPIEIYGPVGLRDFIWRTMELSHTELVFHYVVHELVPTADQCPAEELKEFAH     71 - 140
VNRADSPPKEEQGRTILLDSEENSYLLFDDEQFVVKAFRLFHRIPSFGFSVVEKKRPGKLNAQKLKDLGV    141 - 210
PPGPAYGKLKNGISVVLENGVTISPQDVLKKPIVGRKICILGDCSGVVGDGGVKLCFEADLLIHEATLDD    211 - 280
AQMDKAKEHGHSTPQMAATFAKLCRAKRLVLTHFSQRYKPVALAREGETDGIAELKKQAESVLDLQEVTL    281 - 350
AEDFMVISIPIKK                                                             351 - 363
//

Text Mined References (11)

PMID Year Title
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
21593607 Involvement of human ELAC2 gene product in 3' end processing of mitochondrial tRNAs.
21559454 2011 Localization of human RNase Z isoforms: dual nuclear/mitochondrial targeting of the ELAC2 gene product by alternative translation initiation.
18573253 2008 Regulation of the human tRNase ZS gene expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12711671 2003 A candidate prostate cancer susceptibility gene encodes tRNA 3' processing endoribonuclease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11401430 2001 Physical and transcriptional map of a 311-kb segment of chromosome 18q21, a candidate lung tumor suppressor locus.
11175785 2001 A candidate prostate cancer susceptibility gene at chromosome 17p.
More...