Property Summary

Ligand Count 28
NCBI Gene PubMed Count 11
PubMed Score 16.38
PubTator Score 8.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.8e-04
lung cancer 4740 1.9e-03
invasive ductal carcinoma 2951 2.5e-03

Expression

  Differential Expression (3)

Disease log2 FC p
invasive ductal carcinoma 1.300 2.5e-03
lung cancer 1.200 1.9e-03
psoriasis 1.200 5.8e-04

Gene RIF (2)

AA Sequence

MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAEL      1 - 70
FQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRK     71 - 140
YTELPHGAISEDQAVGPADIPCDSTGQTST                                            141 - 170
//

Text Mined References (20)

PMID Year Title