Property Summary

NCBI Gene PubMed Count 10
PubMed Score 12.43
PubTator Score 8.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung cancer 4473 3.62808766031874E-4
psoriasis 6685 5.80088012275558E-4
invasive ductal carcinoma 2950 0.00247325251713454

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.200 0.001
lung cancer 1.700 0.000
invasive ductal carcinoma 1.300 0.002

Synonym

Accession Q9H773
Symbols CDA03
RS21C6
XTP3TPA

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
24467396 DCTPP1 has a central role in the balance of dCTP and the metabolism of deoxycytidine analogues.
21671327 Human dCTP pyrophosphatase 1 binds and is inhibited by the small molecule triptolide in vitro.

AA Sequence

MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAEL      1 - 70
FQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRK     71 - 140
YTELPHGAISEDQAVGPADIPCDSTGQTST                                            141 - 170
//

Text Mined References (19)

PMID Year Title
26075750 2015 Human dCTP pyrophosphatase 1 promotes breast cancer cell growth and stemness through the modulation on 5-methyl-dCTP metabolism and global hypomethylation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24467396 2014 The NTP pyrophosphatase DCTPP1 contributes to the homoeostasis and cleansing of the dNTP pool in human cells.
24085278 2013 dCTP pyrophosphohydrase exhibits nucleic accumulation in multiple carcinomas.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21671327 2011 Triptolide directly inhibits dCTP pyrophosphatase.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...