Property Summary

NCBI Gene PubMed Count 19
Grant Count 83
R01 Count 20
Funding $16,350,518.95
PubMed Score 590.68
PubTator Score 7.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.300 0.005
posterior fossa group A ependymoma -1.900 0.000
oligodendroglioma -1.200 0.010
glioblastoma -2.300 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
primitive neuroectodermal tumor -1.900 0.003
Atopic dermatitis -1.100 0.019
colon cancer -2.100 0.000
breast carcinoma -1.600 0.000
adult high grade glioma -1.700 0.001
sonic hedgehog group medulloblastoma -1.700 0.001
pilocytic astrocytoma -1.800 0.000
psoriasis -1.700 0.000
Breast cancer -1.600 0.015
invasive ductal carcinoma -2.397 0.001
pituitary cancer -1.900 0.004

Synonym

Accession Q9H772 Q86UD9
Symbols PRDC
DAND3
CKTSF1B2

Gene

Gene RIF (8)

PMID Text
26416033 mutations associated with tooth malformations
26239165 Gremlin 2 inhibits adipocyte differentiation through activation of Wnt/beta-catenin signaling
25443231 GREM2 variants have been identified in atrial fibrillation cohort studies, demonstrating abnormalities in cardiac excitation - supra ventricular tachycardia and atrial fibrillation.
23902946 The minor allele of rs4454537 is significantly associated with low bone density at the total hip of southern Chinese people. Our study further suggests GREM2 as a novel susceptibility gene for osteoporosis.
23437003 and that a genetic variant in the FMN2/GREM2 locus influences GREM2 expression in osteoblasts and thereby trabecular number and thickness as well as fracture risk.
23223679 Through regulation of bone morphogenetic protein signaling, GREM2 is required for cardiac laterality and atrial differentiation during embryonic development.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19626040 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIKEVLASSQEALVVTERKYLKS      1 - 70
DWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEESFQSCAFCKPQRVTSVLVELECPGL     71 - 140
DPPFRLKKIQKVKQCRCMSVNLSDSDKQ                                              141 - 168
//

Text Mined References (19)

PMID Year Title
26416033 2015 GREMLIN 2 Mutations and Dental Anomalies.
26239165 2015 Gremlin 2 inhibits adipocyte differentiation through activation of Wnt/?-catenin signaling.
25443231 2014 Risk factors and genetics of atrial fibrillation.
23902946 2013 Genetic variants in GREM2 are associated with bone mineral density in a southern Chinese population.
23437003 2013 Genetic determinants of trabecular and cortical volumetric bone mineral densities and bone microstructure.
23223679 2013 Functional modeling in zebrafish demonstrates that the atrial-fibrillation-associated gene GREM2 regulates cardiac laterality, cardiomyocyte differentiation and atrial rhythm.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
22199011 2012 Association between chromosome 9p21 variants and the ankle-brachial index identified by a meta-analysis of 21 genome-wide association studies.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19626040 2009 Follow-up examination of linkage and association to chromosome 1q43 in multiple sclerosis.
More...