Property Summary

NCBI Gene PubMed Count 23
PubMed Score 620.59
PubTator Score 7.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.700 1.3e-03
astrocytic glioma -1.300 4.8e-03
Astrocytoma, Pilocytic -1.800 4.3e-07
Atopic dermatitis -1.100 1.9e-02
atypical teratoid / rhabdoid tumor -1.700 1.5e-04
Breast cancer -1.300 3.9e-02
breast carcinoma -1.600 7.5e-05
colon cancer -2.100 7.4e-06
ependymoma -1.400 1.6e-02
glioblastoma -1.700 1.9e-08
group 3 medulloblastoma -1.100 2.4e-02
invasive ductal carcinoma -2.397 5.7e-04
oligodendroglioma -1.200 9.7e-03
pituitary cancer -1.900 3.7e-03
primitive neuroectodermal tumor -1.300 6.6e-03
psoriasis -1.500 5.0e-26

Gene RIF (12)

AA Sequence

MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIKEVLASSQEALVVTERKYLKS      1 - 70
DWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEESFQSCAFCKPQRVTSVLVELECPGL     71 - 140
DPPFRLKKIQKVKQCRCMSVNLSDSDKQ                                              141 - 168
//

Text Mined References (23)

PMID Year Title