Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.48
PubTator Score 1.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 4.90190244800784E-11
Duchenne muscular dystrophy 602 4.34628063096406E-7
limb girdle muscular dystrophy 2A 156 1.46641887655359E-5
Becker muscular dystrophy 187 5.04255895122259E-5
atypical teratoid / rhabdoid tumor 4369 7.06828007262704E-5
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00536571740559472
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00898731086004252
non primary Sjogren syndrome sicca 840 0.0203927054202135
Disease Target Count Z-score Confidence
lung adenocarcinoma 2714 3.003 1.5

Expression

Synonym

Accession Q9H765 A8K1P2 Q547Q2 ASB-8
Symbols PP14212

Gene

  Ortholog (9)

Gene RIF (1)

PMID Text
12559969 molecular cloning and characterization of the human ASB-8 gene

AA Sequence

MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCTHGTLKPLHCACMVSDADCVE      1 - 70
LLLEKGAEVNALDGYNRTALHYAAEKDEACVEVLLEYGANPNALDGNRDTPLHWAAFKNNAECVRALLES     71 - 140
GASVNALDYNNDTPLSWAAMKGNLESVSILLDYGAEVRVINLIGQTPISRLVALLVRGLGTEKEDSCFEL    141 - 210
LHRAVGHFELRKNGTMPREVARDPQLCEKLTVLCSAPGTLKTLARYAVRRSLGLQYLPDAVKGLPLPASL    211 - 280
KEYLLLLE                                                                  281 - 288
//

Text Mined References (10)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12559969 2003 Molecular cloning and characterization of the human ASB-8 gene encoding a novel member of ankyrin repeat and SOCS box containing protein family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12076535 2002 The SOCS box: a tale of destruction and degradation.