Knowledge Summary

Patent

No data available

Synonym

Accession Q9H761 Q6IA18
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MVQQDVQGLKAQSAGLSISQHLLSGCHGNIIPNPTTLSSRETAIIRRDLGFPRGSWASFLKRLLLSSATR      1 - 70
NTRPAHPQHLCGDEGQSPTVPLPVLMRKGGKKTYPERLQYGHDTFKKPVLWSHDQKPECGEGQQPASEQP     71 - 140
ARRGVVNLGLVPRHDWLRAQCSTLWNVPWASVAFLSFAGRGLLPLWQLVS                        141 - 190
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.