Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.63
PubTator Score 1.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
nephrosclerosis 333 2.3e-02
active ulcerative colitis 764 3.3e-02
colon cancer 1478 3.6e-02
Disease Target Count Z-score Confidence
Decubitus ulcer 13 3.683 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
active ulcerative colitis -1.154 3.3e-02
colon cancer -1.500 3.6e-02
nephrosclerosis -1.527 2.3e-02

Gene RIF (1)

AA Sequence

MKVTGITILFWPLSMILLSDKIQSSKREVQCNFTEKNYTLIPADIKKDVTILDLSYNQITLNGTDTRVLQ      1 - 70
TYFLLTELYLIENKVTILHNNGFGNLSSLEILNICRNSIYVIQQGAFLGLNKLKQLYLCQNKIEQLNADV     71 - 140
FVPLRSLKLLNLQGNLISYLDVPPLFHLELITLYGNLWNCSCSLFNLQNWLNTSNVTLENENITMCSYPN    141 - 210
SLQSYNIKTVPHKAECHSKFPSSVTEDLYIHFQPISNSIFNSSSNNLTRNSEHEPLGKSWAFLVGVVVTV    211 - 280
LTTSLLIFIAIKCPIWYNILLSYNHHRLEEHEAETYEDGFTGNPSSLSQIPETNSEETTVIFEQLHSFVV    281 - 350
DDDGFIEDKYIDIHELCEEN                                                      351 - 370
//

Text Mined References (5)

PMID Year Title