Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.63
PubTator Score 1.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ulcerative colitis 2087 2.49101968518835E-6
colon cancer 1475 0.00970448961851399
nephrosclerosis 329 0.022526747506676

Expression

  Differential Expression (3)

Disease log2 FC p
nephrosclerosis -1.527 0.023
colon cancer -2.800 0.010
ulcerative colitis -1.900 0.000

Synonym

Accession Q9H756 A0AV00 B9EG91
Symbols

Gene

  Ortholog (10)

Gene RIF (1)

PMID Text
19679103 LRRC19 may play an important role in inducing innate immune responses in certain tissues such as the kidney.

AA Sequence

MKVTGITILFWPLSMILLSDKIQSSKREVQCNFTEKNYTLIPADIKKDVTILDLSYNQITLNGTDTRVLQ      1 - 70
TYFLLTELYLIENKVTILHNNGFGNLSSLEILNICRNSIYVIQQGAFLGLNKLKQLYLCQNKIEQLNADV     71 - 140
FVPLRSLKLLNLQGNLISYLDVPPLFHLELITLYGNLWNCSCSLFNLQNWLNTSNVTLENENITMCSYPN    141 - 210
SLQSYNIKTVPHKAECHSKFPSSVTEDLYIHFQPISNSIFNSSSNNLTRNSEHEPLGKSWAFLVGVVVTV    211 - 280
LTTSLLIFIAIKCPIWYNILLSYNHHRLEEHEAETYEDGFTGNPSSLSQIPETNSEETTVIFEQLHSFVV    281 - 350
DDDGFIEDKYIDIHELCEEN                                                      351 - 370
//

Text Mined References (5)

PMID Year Title
19679103 2009 LRRC19, a novel member of the leucine-rich repeat protein family, activates NF-kappaB and induces expression of proinflammatory cytokines.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.