Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.14
PubTator Score 4.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 2.7e-03
atypical teratoid / rhabdoid tumor -1.900 2.0e-07
Breast cancer -1.300 5.0e-09
Chronic Lymphocytic Leukemia 1.215 4.2e-03
colon cancer 2.300 1.5e-02
cutaneous lupus erythematosus 2.100 9.4e-04
ependymoma -1.200 1.6e-02
glioblastoma 2.300 4.0e-03
group 3 medulloblastoma -1.900 1.7e-06
head and neck cancer and chronic obstruc... 1.100 7.3e-04
interstitial cystitis 1.900 5.8e-03
intraductal papillary-mucinous carcinoma... -1.200 5.9e-04
lung cancer 1.100 2.1e-04
medulloblastoma, large-cell -2.300 4.9e-07
non primary Sjogren syndrome sicca -1.200 2.3e-02
non-small cell lung cancer -1.085 1.2e-08
oligodendroglioma -1.100 5.8e-03
osteosarcoma -1.841 9.5e-03
ovarian cancer -1.700 1.5e-09
subependymal giant cell astrocytoma 1.929 5.7e-03
tuberculosis -1.300 3.4e-03
ulcerative colitis 1.100 2.5e-04

Gene RIF (7)

AA Sequence

MVSQSTVRQDSPVEPWEGISDHSGIIDGSPRLLNTDHPPCQLDIRLMRHKAVWINPQDVQQQPQDLQSQV      1 - 70
PAAGNSGTHFVTDAASPSGPSPSCLGDSLAETTLSEDTTDSVGSASPHGSSEKSSSFSLSSTEVHMVRPG     71 - 140
YSHRVSLPTSPGILATSPYPETDSAFFEPSHLTSAADEGAVQVSRRTISSNSFSPEVFVLPVDVEKENAH    141 - 210
FYVADMIISAMEKMKCNILSQQQTESWSKEVSGLLGSDQPDSEMTFDTNIKQESGSSTSSYSGYEGCAVL    211 - 280
QVSPVTETRTYHDVKEICKCDVDEFVILELGDFNDITETCSCSCSSSKSVTYEPDFNSAELLAKELYRVF    281 - 350
QKCWILSVVNSQLAGSLSAAGSIVVNEECVRKDFESSMNVVQEIKFKSRIRGTEDWAPPRFQIIFNIHPP    351 - 420
LKRDLVVAAQNFFCAGCGTPVEPKFVKRLRYCEYLGKYFCDCCHSYAESCIPARILMMWDFKKYYVSNFS    421 - 490
KQLLDSIWHQPIFNLLSIGQSLYAKAKELDRVKEIQEQLFHIKKLLKTCRFANSALKEFEQVPGHLTDEL    491 - 560
HLFSLEDLVRIKKGLLAPLLKDILKASLAHVAGCELCQGKGFICEFCQNTTVIFPFQTATCRRCSACRAC    561 - 630
FHKQCFQSSECPRCARITARRKLLESVASAAT                                          631 - 662
//

Text Mined References (19)

PMID Year Title