Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.12
PubTator Score 4.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
Breast cancer 3099 1.75043805657472E-11
non-small cell lung cancer 2798 1.22303301851308E-8
ovarian cancer 8492 1.73391525662657E-8
medulloblastoma, large-cell 6234 2.35271309168124E-8
atypical teratoid / rhabdoid tumor 4369 5.48532332794953E-7
group 3 medulloblastoma 2254 1.82307077923591E-5
posterior fossa group B ependymoma 1530 1.53466549540541E-4
osteosarcoma 7933 1.75806191967021E-4
lung cancer 4473 1.86365910787502E-4
primary Sjogren syndrome 789 2.26954972881889E-4
ulcerative colitis 2087 2.53553660930467E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.86247394538093E-4
head and neck cancer and chronic obstructive pulmonary disease 237 8.94016978164061E-4
cutaneous lupus erythematosus 1056 9.36953418064268E-4
subependymal giant cell astrocytoma 2287 0.00253967899462178
interstitial cystitis 2299 0.00255374968621205
pilocytic astrocytoma 3086 0.00319075908758926
tuberculosis 1563 0.00342860577990656
glioblastoma 5572 0.00395455010680816
chronic lymphocytic leukemia 244 0.00415161274210596
oligodendroglioma 2849 0.00583901638084804
colon cancer 1475 0.015452069865835
Disease Target Count Z-score Confidence
Cervical cancer 23 4.013 2.0

Expression

Synonym

Accession Q9H714 A8KAG9 A8XR19 B3KS87 Q5W051 Q5W053 Q6PJ74 Q6PK94 Q86XH7 Q8N5J6
Symbols C13orf18
KIAA0226L

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG

 Compartment GO Term (1)

Gene RIF (6)

PMID Text
25169519 MethyLight data demonstrated that C13orf18 and C1orf166 could not be considered as specific, sensitive and suitable prognostic biomarkers in cervical dysplasia related Papillomavirus Infections.
23522960 Re-activation of C13ORF18 led to partial demethylation of the C13ORF18 promoter and decreased repressive histone methylation.
21796628 Data suggest that the four-gene methylation panel might provide an alternative triage test after primary high-risk papillomavirus (hr-HPV) testing.
19843677 Methylation of C13orf18 in cervical scrapings is strongly associated with high-grade cervical intraepithelial neoplasia and cervical cancer.
18987618 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18649358 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVSQSTVRQDSPVEPWEGISDHSGIIDGSPRLLNTDHPPCQLDIRLMRHKAVWINPQDVQQQPQDLQSQV      1 - 70
PAAGNSGTHFVTDAASPSGPSPSCLGDSLAETTLSEDTTDSVGSASPHGSSEKSSSFSLSSTEVHMVRPG     71 - 140
YSHRVSLPTSPGILATSPYPETDSAFFEPSHLTSAADEGAVQVSRRTISSNSFSPEVFVLPVDVEKENAH    141 - 210
FYVADMIISAMEKMKCNILSQQQTESWSKEVSGLLGSDQPDSEMTFDTNIKQESGSSTSSYSGYEGCAVL    211 - 280
QVSPVTETRTYHDVKEICKCDVDEFVILELGDFNDITETCSCSCSSSKSVTYEPDFNSAELLAKELYRVF    281 - 350
QKCWILSVVNSQLAGSLSAAGSIVVNEECVRKDFESSMNVVQEIKFKSRIRGTEDWAPPRFQIIFNIHPP    351 - 420
LKRDLVVAAQNFFCAGCGTPVEPKFVKRLRYCEYLGKYFCDCCHSYAESCIPARILMMWDFKKYYVSNFS    421 - 490
KQLLDSIWHQPIFNLLSIGQSLYAKAKELDRVKEIQEQLFHIKKLLKTCRFANSALKEFEQVPGHLTDEL    491 - 560
HLFSLEDLVRIKKGLLAPLLKDILKASLAHVAGCELCQGKGFICEFCQNTTVIFPFQTATCRRCSACRAC    561 - 630
FHKQCFQSSECPRCARITARRKLLESVASAAT                                          631 - 662
//

Text Mined References (14)

PMID Year Title
25169519 2014 C13orf18 and C1orf166 (MULAN) DNA genes methylation are not associated with cervical cancer and precancerous lesions of human papillomavirus genotypes in Iranian women.
23522960 2013 Functional validation of putative tumor suppressor gene C13ORF18 in cervical cancer by Artificial Transcription Factors.
21796628 2012 A four-gene methylation marker panel as triage test in high-risk human papillomavirus positive patients.
19843677 2009 Methylation markers for CCNA1 and C13ORF18 are strongly associated with high-grade cervical intraepithelial neoplasia and cervical cancer in cervical scrapings.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18987618 2009 Screening for replication of genome-wide SNP associations in sporadic ALS.
18649358 2008 Replication of a genome-wide case-control study of esophageal squamous cell carcinoma.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
More...