Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 2.05446802120635E-10
psoriasis 6685 1.17394621714263E-5
breast carcinoma 1614 1.29157826521361E-5
glioblastoma 5572 7.07725118661062E-5

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -2.300 0.000
osteosarcoma -2.509 0.000
glioblastoma 1.100 0.000
breast carcinoma 1.300 0.000

Synonym

Accession Q9H707 B3KUE9 Q6P5A6
Symbols

Gene

  Ortholog (2)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG

Gene RIF (2)

PMID Text
20356460 ZNF552 was a transcriptional repressor, and overexpression of ZNF552 in the COS-7 cells inhibited the transcriptional activities of AP-1 and SRE, which could be relieved through RNAi analysis.
18976975 Knockdown of zinc finger protein 552 (ZNF552) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MAAAALRFPVQGTVTFEDVAVKFTQEEWNLLSEAQRCLYRDVTLENLALMSSLGCWCGVEDEAAPSKQSI      1 - 70
YIQRETQVRTPMAGVSPKKAHPCEMCGPILGDILHVADHQGTHHKQKLHRCEAWGNKLYDSGNFHQHQNE     71 - 140
HIGEKPYRGSVEEALFAKRCKLHVSGESSVFSESGKDFLLRSGLLQQEATHTGKSNSKTECVSLFHGGKS    141 - 210
HYSCGGCMKHFSTKDILSQHERLLPTEEPSVWCECGKSSSKYDSFSNHQGVHTREKPYTCGICGKLFNSK    211 - 280
SHLLVHQRIHTGEKPYECEVCQKFFRHKYHLIAHQRVHTGERPYECSDCGKSFTHSSTFRVHKRVHTGQK    281 - 350
PYECSECGKSFAESSSLTKHRRVHTGEKPYGCSECEKKFRQISSLRHHQRVHKRKGL                 351 - 407
//

Text Mined References (8)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
20356460 2010 ZNF552, a novel human KRAB/C2H2 zinc finger protein, inhibits AP-1- and SRE-mediated transcriptional activity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.