Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.1e-10
psoriasis 6694 1.2e-05
breast carcinoma 1638 1.3e-05
glioblastoma 5792 7.1e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma 1.300 1.3e-05
glioblastoma 1.100 7.1e-05
osteosarcoma -2.509 2.1e-10
psoriasis -2.300 1.2e-05

Gene RIF (2)

AA Sequence

MAAAALRFPVQGTVTFEDVAVKFTQEEWNLLSEAQRCLYRDVTLENLALMSSLGCWCGVEDEAAPSKQSI      1 - 70
YIQRETQVRTPMAGVSPKKAHPCEMCGPILGDILHVADHQGTHHKQKLHRCEAWGNKLYDSGNFHQHQNE     71 - 140
HIGEKPYRGSVEEALFAKRCKLHVSGESSVFSESGKDFLLRSGLLQQEATHTGKSNSKTECVSLFHGGKS    141 - 210
HYSCGGCMKHFSTKDILSQHERLLPTEEPSVWCECGKSSSKYDSFSNHQGVHTREKPYTCGICGKLFNSK    211 - 280
SHLLVHQRIHTGEKPYECEVCQKFFRHKYHLIAHQRVHTGERPYECSDCGKSFTHSSTFRVHKRVHTGQK    281 - 350
PYECSECGKSFAESSSLTKHRRVHTGEKPYGCSECEKKFRQISSLRHHQRVHKRKGL                 351 - 407
//

Text Mined References (9)

PMID Year Title