Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.38
PubTator Score 3.34

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count
Electrocardiogram: P-R interval 9
Disease Target Count P-value
lung carcinoma 2844 6.91881243195166E-11
malignant mesothelioma 3163 6.4556885368646E-9
ovarian cancer 8492 4.31333080064993E-7
sonic hedgehog group medulloblastoma 1482 2.07973744773382E-5
glioblastoma 5572 4.23583966114893E-5
invasive ductal carcinoma 2950 5.53374239930945E-5
adrenocortical carcinoma 1427 8.66332326453453E-5
ependymoma 2514 1.02848202064293E-4
cystic fibrosis 1670 1.18015620085745E-4
interstitial cystitis 2299 7.59453123869647E-4
ulcerative colitis 2087 0.00503529797979456
medulloblastoma, large-cell 6234 0.0236900402478287
primitive neuroectodermal tumor 3031 0.0253903840750501
atypical teratoid/rhabdoid tumor 1095 0.0329297943764799
colon cancer 1475 0.0332143702946323
spina bifida 1064 0.0440788785007886


  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -4.100 0.000
ependymoma -1.300 0.000
glioblastoma -1.100 0.000
sonic hedgehog group medulloblastoma -2.200 0.000
cystic fibrosis 1.216 0.000
medulloblastoma, large-cell -1.400 0.024
primitive neuroectodermal tumor -1.200 0.025
adrenocortical carcinoma -1.559 0.000
colon cancer -1.100 0.033
interstitial cystitis -2.000 0.001
atypical teratoid/rhabdoid tumor -1.100 0.033
invasive ductal carcinoma -1.959 0.000
lung carcinoma 1.100 0.000
spina bifida -1.918 0.044
ulcerative colitis -1.200 0.005
ovarian cancer -1.900 0.000

Gene RIF (6)

26164232 suggest that the interplay between 14-3-3, SAM domain and CABIT domain might be responsible for the distribution of GAREM1 in mammalian cells.
24003223 Data indicate that a subtype of GAREM, GAREM2, is specifically expressed in the mouse, rat, and human brain.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19509291 Extracellular signal-regulated kinase activation in response to epidermal growth factor stimulation is regulated by the expression of GAREM in COS-7 and HeLa cells.
19240061 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of family with sequence similarity 59, member A (FAM59A; C18orf11) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

NLLVQLTEEILSEDFKLSKLQVKKIMQFINGWRPKI                                      841 - 876

Text Mined References (18)

PMID Year Title
26164232 2015 Functional relationship between CABIT, SAM and 14-3-3 binding domains of GAREM1 that play a role in its subcellular localization.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25416956 2014 A proteome-scale map of the human interactome network.
25035420 2014 Identification of three novel genetic variations associated with electrocardiographic traits (QRS duration and PR interval) in East Asians.
24003223 2013 A brain-specific Grb2-associated regulator of extracellular signal-regulated kinase (Erk)/mitogen-activated protein kinase (MAPK) (GAREM) subtype, GAREM2, contributes to neurite outgrowth of neuroblastoma cells by regulating Erk signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21706016 2011 Selected reaction monitoring mass spectrometry reveals the dynamics of signaling through the GRB2 adaptor.
20936779 2010 A human MAP kinase interactome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.