Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.57
PubTator Score 3.34

Knowledge Summary


No data available


  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma -1.325 6.8e-03
atypical teratoid/rhabdoid tumor -1.100 3.3e-02
colon cancer -1.100 3.3e-02
cystic fibrosis 1.216 1.2e-04
ependymoma -1.300 1.0e-04
glioblastoma -1.100 4.2e-05
group 3 medulloblastoma -1.100 4.4e-03
interstitial cystitis -1.500 2.1e-03
invasive ductal carcinoma -1.959 5.5e-05
lung carcinoma 1.100 6.9e-11
malignant mesothelioma -4.100 6.5e-09
medulloblastoma, large-cell -1.100 3.4e-02
ovarian cancer -1.900 4.3e-07
primitive neuroectodermal tumor -1.200 2.5e-02
spina bifida -1.918 4.4e-02
ulcerative colitis -1.100 1.6e-04


Accession Q9H706 Q0VAG3 Q0VAG4 Q8ND03 Q9BSF5
Symbols GAREM




  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

NLLVQLTEEILSEDFKLSKLQVKKIMQFINGWRPKI                                      841 - 876

Text Mined References (18)

PMID Year Title