Property Summary

Ligand Count 82
NCBI Gene PubMed Count 89
PubMed Score 119.05
PubTator Score 88.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Protein-protein Interaction (4)

Gene RIF (66)

AA Sequence

MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSK      1 - 70
RHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPN     71 - 140
GDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTV    141 - 210
WYFDAEERAEAKKKFRNLTRKTESALTED                                             211 - 239
//

Text Mined References (91)

PMID Year Title