Property Summary

NCBI Gene PubMed Count 83
Grant Count 53
R01 Count 38
Funding $4,235,566.32
PubMed Score 102.88
PubTator Score 88.43

Knowledge Summary

Patent

No data available

Expression

Gene RIF (60)

PMID Text
26997627 In pancreatic Beta cells, knock-down of PHD3 inhibited glucose-stimulated insulin secretion.
26940742 The selective efficacy of PZ was further demonstrated at the cellular level by observing inhibition of the PHD3-dependent DNA damage response pathway without stabilization of HIF-1alpha.
26372732 Loss of PHD3 expression is associated with breast cancer.
26223520 The data demonstrates that PHD3 can drive cell cycle entry at the G1/S transition through decreasing the half-life of p27 that occurs by attenuating p27S10 phosphorylation.
25542265 The enhanced expression of PHD3 might likely contribute to the poor neovascularization and affect the biological characterization in PDAC cancer cells
25420773 PHD3 loss sustains cell proliferation through the control of EGFR.
25420589 PHD3 controls EGFR activity by acting as a scaffolding protein that associates with the endocytic adaptor Eps15 and promotes the internalization of EGFR.
25380826 PHD3 SUMOylation occurs at a cluster of four lysines at the C-terminal end of the protein. Furthermore, PHD3 SUMOylation by SUMO2 or SUMO3 contributes to PHD3-mediated repression of HIF1-dependent transcriptional activity.
25088999 PHD3 depletion did not affect the expression of the PDH-E1alpha, E1beta, and E2 subunits, or the phosphorylation status of E1alpha, but destabilized the PDH complex (PDC), resulting in less functional PDC.
25081707 HIFPH3 expression in human non-small cell lung cancer lesions is significantly higher than that in para-cancerous and normal lung tissues and is positively associated with lymph node metastasis and microvessel density.
More...

AA Sequence

MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSK      1 - 70
RHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPN     71 - 140
GDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTV    141 - 210
WYFDAEERAEAKKKFRNLTRKTESALTED                                             211 - 239
//

Text Mined References (85)

PMID Year Title
26997627 2016 Role of prolyl hydroxylase domain proteins in the regulation of insulin secretion.
26972000 2016 Substrate-Trapped Interactors of PHD3 and FIH Cluster in Distinct Signaling Pathways.
26940742 2016 Pyrithione Zn selectively inhibits hypoxia-inducible factor prolyl hydroxylase PHD3.
26372732 2015 Distinct breast cancer stem/progenitor cell populations require either HIF1? or loss of PHD3 to expand under hypoxic conditions.
26223520 2015 Hypoxia inducible prolyl hydroxylase PHD3 maintains carcinoma cell growth by decreasing the stability of p27.
25542265 2015 Increased expression of PHD3 represses the HIF-1 signaling pathway and contributes to poor neovascularization in pancreatic ductal adenocarcinoma.
25420773 2014 Loss of PHD3 allows tumours to overcome hypoxic growth inhibition and sustain proliferation through EGFR.
25420589 2014 PHD3 regulates EGFR internalization and signalling in tumours.
25416956 2014 A proteome-scale map of the human interactome network.
25380826 2015 PHD3-SUMO conjugation represses HIF1 transcriptional activity independently of PHD3 catalytic activity.
More...