Property Summary

NCBI Gene PubMed Count 23
PubMed Score 21.44
PubTator Score 13.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.7e-05
osteosarcoma 7950 5.9e-05
non primary Sjogren syndrome sicca 891 1.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (3)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.300 1.9e-02
osteosarcoma -1.608 5.9e-05
psoriasis -2.100 1.7e-05

Gene RIF (8)

AA Sequence

MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHHGTGHPESAGEHALEPPAPAG      1 - 70
ASASTPPPPAPEAQLPPFPRELAGRSAGGSSPEGGEDSDREDGNYCPPVKRERTSSLTQFPPSQSEERSS     71 - 140
GFRLKPPTLIHGQAPSAGLPSQKPKEQQRSVLRPAVLQAPQPKALSQTVPSSGTNGVSLPADCTGAVPAA    141 - 210
SPDTAAWRSPSEAADEVCALEEKEPQKNESSNASEEEACEKKDPATQQAFVFGQNLRDRVKLINESVDEA    211 - 280
DMENAGHPSADTPTATNYFLQYISSSLENSTNSADASSNKFVFGQNMSERVLSPPKLNEVSSDANRENAA    281 - 350
AESGSESSSQEATPEKESLAESAAAYTKATARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWVE    351 - 420
RGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIRITAMDTEDQGVKVFLI    421 - 490
SASSKDTGQLYAALHHRILALRSRVEQEQEAKMPAPEPGAAPSNEEDDSDDDDVLAPSGATAAGAGDEGD    491 - 560
GQTTGST                                                                   561 - 567
//

Text Mined References (35)

PMID Year Title