Property Summary

NCBI Gene PubMed Count 22
Grant Count 34
R01 Count 15
Funding $2,171,622.91
PubMed Score 20.52
PubTator Score 13.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -2.100 0.000
osteosarcoma -1.608 0.000
non primary Sjogren syndrome sicca 1.300 0.019

Gene RIF (7)

PMID Text
26763446 RANBP3 regulates melanoma cell proliferation and probably a potential target for molecular targeted therapy.
23303829 RanBP3 is involved in vRNP nuclear export. The function of RanBP3 during vRNP nuclear export is regulated by phosphorylation at Ser58. RanBP3 phosphorylation is modulated by both PI3K/Akt and Ras/ERK/RSK pathways in the late phase of viral infection.
21364925 Crystal structure of the Ran-binding domain (RBD) from RanBP3 and compare it to RBD structures from RanBP1 and RanBP2 in complex with Ran and CRM1.
19289081 RanBP3 directly recognizes dephosphorylated Smad2/3, which results from the activity of nuclear Smad phosphatases, and mediates nuclear export of Smad2/3 in a Ran-dependent manner.
18280241 RANBP3 phosphorylation links the Ras and PI3-kinase pathways to nucleocytoplasmic transport.
14612415 A multifunctional domain in CRM1 (exportin 1) mediates RanBP3 binding and multimerization of human T-cell leukemia virus type 1 Rex protein.
11932251 RanBP3 stimulates export by enhancing the affinity of Crm1 for Ran-GTP and cargo.

AA Sequence

MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHHGTGHPESAGEHALEPPAPAG      1 - 70
ASASTPPPPAPEAQLPPFPRELAGRSAGGSSPEGGEDSDREDGNYCPPVKRERTSSLTQFPPSQSEERSS     71 - 140
GFRLKPPTLIHGQAPSAGLPSQKPKEQQRSVLRPAVLQAPQPKALSQTVPSSGTNGVSLPADCTGAVPAA    141 - 210
SPDTAAWRSPSEAADEVCALEEKEPQKNESSNASEEEACEKKDPATQQAFVFGQNLRDRVKLINESVDEA    211 - 280
DMENAGHPSADTPTATNYFLQYISSSLENSTNSADASSNKFVFGQNMSERVLSPPKLNEVSSDANRENAA    281 - 350
AESGSESSSQEATPEKESLAESAAAYTKATARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWVE    351 - 420
RGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIRITAMDTEDQGVKVFLI    421 - 490
SASSKDTGQLYAALHHRILALRSRVEQEQEAKMPAPEPGAAPSNEEDDSDDDDVLAPSGATAAGAGDEGD    491 - 560
GQTTGST                                                                   561 - 567
//

Text Mined References (34)

PMID Year Title
26763446 2016 RanBP3 Regulates Melanoma Cell Proliferation via Selective Control of Nuclear Export.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23303829 2013 The role of Ran-binding protein 3 during influenza A virus replication.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21960005 2011 PPM1A dephosphorylates RanBP3 to enable efficient nuclear export of Smad2 and Smad3.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21364925 2011 Insights into the function of the CRM1 cofactor RanBP3 from the structure of its Ran-binding domain.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...