Property Summary

NCBI Gene PubMed Count 14
Grant Count 1
Funding $177,257.4
PubMed Score 3.19
PubTator Score 4.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
group 4 medulloblastoma -1.100 0.000

Gene RIF (3)

PMID Text
24387786 Point mutations are characterized in the RING domain of RNF167 and RNF13.
23353890 mutation of the Godzilla ubiquitylation target lysines on VAMP3 abrogates the formation of enlarged endosomes induced by either Godzilla or RNF167.
23129617 RNF167 is a selective regulator of AMPAR-mediated neurotransmission.

AA Sequence

MHPAAFPLPVVVAAVLWGAAPTRGLIRATSDHNASMDFADLPALFGATLSQEGLQGFLVEAHPDNACSPI      1 - 70
APPPPAPVNGSVFIALLRRFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFI     71 - 140
GERSSEYLRALFVYEKGARVLLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVMIARCIQHRKRLQRNRLTK    141 - 210
EQLKQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPWLTQTRKTCPICKQPVHRGPG    211 - 280
DEDQEEETQGQEEGDEGEPRDHPASERTPLLGSSPTLPTSFGSLAPAPLVFPGPSTDPPLSPPSSPVILV    281 - 350
//

Text Mined References (16)

PMID Year Title
24816252 2014 An atlas of genetic influences on human blood metabolites.
24387786 2014 Tumour-associated mutations of PA-TM-RING ubiquitin ligases RNF167/RNF13 identify the PA domain as a determinant for endosomal localization.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23353890 2013 Goliath family E3 ligases regulate the recycling endosome pathway via VAMP3 ubiquitylation.
23129617 2012 Ubiquitin ligase RNF167 regulates AMPA receptor-mediated synaptic transmission.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16314844 2006 Tumor suppressor candidate TSSC5 is regulated by UbcH6 and a novel ubiquitin ligase RING105.
More...