Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.19
PubTator Score 4.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
group 4 medulloblastoma 1855 6.0e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Asperger syndrome 37 3.992 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
group 4 medulloblastoma -1.100 6.0e-05

Gene RIF (4)

AA Sequence

MHPAAFPLPVVVAAVLWGAAPTRGLIRATSDHNASMDFADLPALFGATLSQEGLQGFLVEAHPDNACSPI      1 - 70
APPPPAPVNGSVFIALLRRFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFI     71 - 140
GERSSEYLRALFVYEKGARVLLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVMIARCIQHRKRLQRNRLTK    141 - 210
EQLKQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPWLTQTRKTCPICKQPVHRGPG    211 - 280
DEDQEEETQGQEEGDEGEPRDHPASERTPLLGSSPTLPTSFGSLAPAPLVFPGPSTDPPLSPPSSPVILV    281 - 350
//

Text Mined References (17)

PMID Year Title