Property Summary

NCBI Gene PubMed Count 3
PubMed Score 11.17
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

AA Sequence

MEPRTGGAANPKGSRGSRGPSPLAGPSARQLLARLDARPLAARAAVDVAALVRRAGATLRLRRKEAVSVL      1 - 70
DSADIEVTDSRLPHATIVDHRPQHRWLETCNAPPQLIQGKAHSAPKPSQASGHFSVELVRGYAGFGLTLG     71 - 140
GGRDVAGDTPLAVRGLLKDGPAQRCGRLEVGDVVLHINGESTQGLTHAQAVERIRAGGPQLHLVIRRPLE    141 - 210
THPGKPRGVGEPRKGVVPSWPDRSPDPGGPEVTGSRSSSTSLVQHPPSRTTLKKTRGSPEPSPEAAADGP    211 - 280
TVSPPERRAEDPNDQIPGSPGPWLVPSEERLSRALGVRGAAQFAQEMAAGRRRH                    281 - 334
//

Text Mined References (5)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.