Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.46

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.41404720179265E-5
colon cancer 1475 0.0426667697828548
lung cancer 4473 0.0432977416878327


  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.242 0.000
colon cancer 1.200 0.043
lung cancer 1.100 0.043


Accession Q9H6Y2 Q9NXK4


  Ortholog (4)

Species Source
Mouse OMA EggNOG Inparanoid
Cow OMA Inparanoid
C. elegans OMA EggNOG
Fruitfly OMA Inparanoid

Gene RIF (2)

19023099 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

KTWSTDDFFAGLREEGEDSMAQEEKEETGDDSD                                         351 - 383

Text Mined References (12)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.