Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.2e-03
colon cancer 1478 4.3e-02
lung cancer 4740 4.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer 1.200 4.3e-02
lung cancer 1.100 4.3e-02
osteosarcoma -1.016 1.2e-03

Gene RIF (2)

AA Sequence

MDRTCEERPAEDGSDEEDPDSMEAPTRIRDTPEDIVLEAPASGLAFHPARDLLAAGDVDGDVFVFSYSCQ      1 - 70
EGETKELWSSGHHLKACRAVAFSEDGQKLITVSKDKAIHVLDVEQGQLERRVSKAHGAPINSLLLVDENV     71 - 140
LATGDDTGGICLWDQRKEGPLMDMRQHEEYIADMALDPAKKLLLTASGDGCLGIFNIKRRRFELLSEPQS    141 - 210
GDLTSVTLMKWGKKVACGSSEGTIYLFNWNGFGATSDRFALRAESIDCMVPVTESLLCTGSTDGVIRAVN    211 - 280
ILPNRVVGSVGQHTGEPVEELALSHCGRFLASSGHDQRLKFWDMAQLRAVVVDDYRRRKKKGGPLRALSS    281 - 350
KTWSTDDFFAGLREEGEDSMAQEEKEETGDDSD                                         351 - 383
//

Text Mined References (12)

PMID Year Title