Property Summary

NCBI Gene PubMed Count 53
PubMed Score 167.71
PubTator Score 52.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Asthma 385 0.0 3.0
Disease Target Count Z-score Confidence
Hypotrichosis 47 0.0 4.0
Disease Target Count
Gapo Syndrome 1

Expression

  Differential Expression (31)

Disease log2 FC p
acute quadriplegic myopathy 1.190 3.3e-03
adrenocortical carcinoma -1.340 6.8e-03
Amyotrophic lateral sclerosis 1.039 6.6e-04
astrocytic glioma 1.900 4.3e-02
Astrocytoma, Pilocytic 1.200 4.3e-06
autosomal dominant Emery-Dreifuss muscul... 1.865 2.0e-03
Breast cancer 2.900 4.3e-02
Duchenne muscular dystrophy 2.019 3.1e-08
ependymoma 1.800 4.5e-03
gastric carcinoma 2.000 1.7e-02
glioblastoma 1.300 1.5e-06
group 4 medulloblastoma -1.600 1.2e-04
hereditary spastic paraplegia -1.165 2.9e-02
intraductal papillary-mucinous carcinoma... -2.200 4.7e-02
invasive ductal carcinoma 1.083 4.1e-02
juvenile dermatomyositis 1.509 1.8e-09
limb girdle muscular dystrophy 2A 1.437 2.5e-04
lung cancer -1.700 1.6e-03
lung carcinoma -1.600 7.3e-16
malignant mesothelioma -2.200 1.5e-07
medulloblastoma, large-cell 1.100 6.7e-06
non-small cell lung cancer 1.205 1.2e-10
oligodendroglioma 1.300 5.8e-03
osteosarcoma 2.515 4.0e-04
ovarian cancer -3.700 2.0e-07
pancreatic cancer 1.100 5.2e-04
pediatric high grade glioma 1.100 1.1e-05
Pick disease 1.100 2.6e-02
primary pancreatic ductal adenocarcinoma 4.472 9.4e-05
primitive neuroectodermal tumor 1.100 5.2e-03
ulcerative colitis 1.700 1.1e-02

Gene RIF (34)

AA Sequence

MATAERRALGIGFQWLSLATLVLICAGQGGRREDGGPACYGGFDLYFILDKSGSVLHHWNEIYYFVEQLA      1 - 70
HKFISPQLRMSFIVFSTRGTTLMKLTEDREQIRQGLEELQKVLPGGDTYMHEGFERASEQIYYENRQGYR     71 - 140
TASVIIALTDGELHEDLFFYSEREANRSRDLGAIVYCVGVKDFNETQLARIADSKDHVFPVNDGFQALQG    141 - 210
IIHSILKKSCIEILAAEPSTICAGESFQVVVRGNGFRHARNVDRVLCSFKINDSVTLNEKPFSVEDTYLL    211 - 280
CPAPILKEVGMKAALQVSMNDGLSFISSSVIITTTHCSDGSILAIALLILFLLLALALLWWFWPLCCTVI    281 - 350
IKEVPPPPAEESEEEDDDGLPKKKWPTVDASYYGGRGVGGIKRMEVRWGEKGSTEEGAKLEKAKNARVKM    351 - 420
PEQEYEFPEPRNLNNNMRRPSSPRKWYSPIKGKLDALWVLLRKGYDRVSVMRPQPGDTGRCINFTRVKNN    421 - 490
QPAKYPLNNAYHTSSPPPAPIYTPPPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPPPSRPPP    491 - 560
RPSV                                                                      561 - 564
//

Text Mined References (56)

PMID Year Title