Property Summary

NCBI Gene PubMed Count 50
PubMed Score 158.65
PubTator Score 52.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
glioblastoma multiforme 347 6.79413343447211E-21
lung carcinoma 2844 7.34215660654395E-16
posterior fossa group B ependymoma 1530 9.90404737061533E-15
non-small cell lung cancer 2798 1.16399135524098E-10
pilocytic astrocytoma 3086 1.3586198188208E-9
juvenile dermatomyositis 1189 1.76548206757529E-9
Duchenne muscular dystrophy 602 3.11629797334127E-8
malignant mesothelioma 3163 1.46733252833145E-7
ovarian cancer 8492 2.01138965588496E-7
osteosarcoma 7933 1.99833622287045E-6
medulloblastoma, large-cell 6234 6.71782657765364E-6
primary pancreatic ductal adenocarcinoma 1271 9.43726665798848E-5
group 4 medulloblastoma 1875 1.23365240114585E-4
limb girdle muscular dystrophy 2A 156 2.5142147651571E-4
pancreatic cancer 2300 4.36987511761365E-4
pediatric high grade glioma 2712 4.92230284088676E-4
Amyotrophic Lateral Sclerosis 432 6.59030422104674E-4
lung cancer 4473 0.00155315319140813
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00196898902404868
acute quadriplegic myopathy 1157 0.00327327811504457
primitive neuroectodermal tumor 3031 0.00515225213227532
adrenocortical carcinoma 1427 0.0067713416726168
ulcerative colitis 2087 0.0114892114281689
gastric carcinoma 832 0.0173619209154561
Pick disease 1893 0.025539081058346
oligodendroglioma 2849 0.0264554587769894
hereditary spastic paraplegia 313 0.0293490923809407
invasive ductal carcinoma 2950 0.0409553921919929
astrocytic glioma 2241 0.0432004352756174
Breast cancer 3099 0.0434036009772049
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0466401732895952
Disease Target Count Z-score Confidence
Asthma 349 0.0 2.0
Disease Target Count Z-score Confidence
Hypotrichosis 29 0.0 4.0

Expression

Synonym

Accession Q9H6X2 A8K7U8 J7K7G4 J7KF88 Q4ZFV6 Q53QD8 Q96P02 Q9NVP3
Symbols ATR
GAPO
TEM8

Gene

PANTHER Protein Class (1)

PDB

3N2N  

  Ortholog (9)

 GWAS Trait (1)

Gene RIF (31)

PMID Text
26677171 TEM8 may be differentially expressed between wound types and loss of this molecule impacts HaCaT growth and migration, potentially implicating this molecule as a factor involved in successful progression of wound healing.
25781883 In the absence of any N-linked glycans, TEM8 fails to fold correctly and is recognized by the ER quality control machinery.
25045128 These studies expand the allelic spectrum in this rare condition and potentially provide insight into the role of ANTXR1 in the regulation of the extracellular matrix.
24742682 TEM8-targeted siRNAs also offered significant protection against lethal toxin in human macrophage-like cells.
24060446 ANTXR2 is expressed by human uterine smooth muscle cell and appears important for normal human uterine smooth muscle cell viability, migration and contractility.
23832666 High ANTXR1 accelerates breast tumor growth and lung metastasis.
23607659 There is an attenuation of ANTXR1 expression post-infection which may be a protective mechanism that has evolved to prevent reinfection.
23602711 Mutations affecting ANTXR1 function are responsible for GAPO syndrome's characteristic generalized defect in extracellular-matrix homeostasis.
22912819 Two new splice variants, one encoding a membrane-bound form of the receptor and the other secreted, which we have designated V4 and V5 (the latter being the only variant expressed in the prostate).
22340594 Disruption of Tem8 results in impaired growth of human tumor xenografts of diverse origin including melanoma, breast, colon, and lung cancer.
More...

AA Sequence

MATAERRALGIGFQWLSLATLVLICAGQGGRREDGGPACYGGFDLYFILDKSGSVLHHWNEIYYFVEQLA      1 - 70
HKFISPQLRMSFIVFSTRGTTLMKLTEDREQIRQGLEELQKVLPGGDTYMHEGFERASEQIYYENRQGYR     71 - 140
TASVIIALTDGELHEDLFFYSEREANRSRDLGAIVYCVGVKDFNETQLARIADSKDHVFPVNDGFQALQG    141 - 210
IIHSILKKSCIEILAAEPSTICAGESFQVVVRGNGFRHARNVDRVLCSFKINDSVTLNEKPFSVEDTYLL    211 - 280
CPAPILKEVGMKAALQVSMNDGLSFISSSVIITTTHCSDGSILAIALLILFLLLALALLWWFWPLCCTVI    281 - 350
IKEVPPPPAEESEEEDDDGLPKKKWPTVDASYYGGRGVGGIKRMEVRWGEKGSTEEGAKLEKAKNARVKM    351 - 420
PEQEYEFPEPRNLNNNMRRPSSPRKWYSPIKGKLDALWVLLRKGYDRVSVMRPQPGDTGRCINFTRVKNN    421 - 490
QPAKYPLNNAYHTSSPPPAPIYTPPPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPPPSRPPP    491 - 560
RPSV                                                                      561 - 564
//

Text Mined References (53)

PMID Year Title
26677171 2016 Tumour endothelial marker-8 in wound healing and its impact on the proliferation and migration of keratinocytes.
25781883 2015 Differential dependence on N-glycosylation of anthrax toxin receptors CMG2 and TEM8.
25045128 2014 Whole exome sequencing identifies three novel mutations in ANTXR1 in families with GAPO syndrome.
24742682 2014 Targeted silencing of anthrax toxin receptors protects against anthrax toxins.
24060446 2014 Anthrax toxin receptor 2 promotes human uterine smooth muscle cell viability, migration and contractility.
23832666 2013 ANTXR1, a stem cell-enriched functional biomarker, connects collagen signaling to cancer stem-like cells and metastasis in breast cancer.
23607659 2013 Exposure to anthrax toxin alters human leucocyte expression of anthrax toxin receptor 1.
23602711 2013 Mutations in ANTXR1 cause GAPO syndrome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22912819 2012 Broad expression analysis of human ANTXR1/TEM8 transcripts reveals differential expression and novel splizce variants.
More...