Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 9.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.8e-04
lung cancer 4740 1.9e-03
astrocytic glioma 2597 3.0e-03
oligodendroglioma 2850 1.1e-02

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.300 3.0e-03
lung cancer 1.100 1.9e-03
oligodendroglioma -1.400 1.1e-02
osteosarcoma -1.007 2.8e-04

Gene RIF (6)

AA Sequence

MDGLQASAGPLRRGRPKRRRKPQPHSGSVLALPLRSRKIRKQLRSVVSRMAALRTQTLPSENSEESRVES      1 - 70
TADDLGDALPGGAAVAAVPDAARREPYGHLGPAELLEASPAARSLQTPSARLVPASAPPARLVEVPAAPV     71 - 140
RVVETSALLCTAQHLAAVQSSGAPATASGPQVDNTGGEPAWDSPLRRVLAELNRIPSSRRRAARLFEWLI    141 - 210
APMPPDHFYRRLWEREAVLVRRQDHTYYQGLFSTADLDSMLRNEEVQFGQHLDAARYINGRRETLNPPGR    211 - 280
ALPAAAWSLYQAGCSLRLLCPQAFSTTVWQFLAVLQEQFGSMAGSNVYLTPPNSQGFAPHYDDIEAFVLQ    281 - 350
LEGRKLWRVYRPRVPTEELALTSSPNFSQDDLGEPVLQTVLEPGDLLYFPRGFIHQAECQDGVHSLHLTL    351 - 420
STYQRNTWGDFLEAILPLAVQAAMEENVEFRRGLPRDFMDYMGAQHSDSKDPRRTAFMEKVRVLVARLGH    421 - 490
FAPVDAVADQRAKDFIHDSLPPVLTDRERALSVYGLPIRWEAGEPVNVGAQLTTETEVHMLQDGIARLVG    491 - 560
EGGHLFLYYTVENSRVYHLEEPKCLEIYPQQADAMELLLGSYPEFVRVGDLPCDSVEDQLSLATTLYDKG    561 - 630
LLLTKMPLALN                                                               631 - 641
//

Text Mined References (18)

PMID Year Title