Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 9.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Synonym

Accession Q9H6W3 B4DT02
Symbols ROX
NO66
MAPJD
URLC2
hsNO66

Gene

PDB

4CCM   4CCN   4CCO   4Y3O   4CCJ   4CCK   4DIQ   4E4H   4Y33   4Y4R  

Gene RIF (6)

PMID Text
26488939 Results show that high expression levels of SMYD2, SETD3, and NO66 in renal cell tumors. Their low expression levels were significantly associated with shorter disease-specific and disease-free survival.
26327385 confirmed the hydroxylase activity of NO66 and showed that oligomerization is required for NO66 to efficiently catalyze the hydroxylation of Rpl8
23620590 hinge domain-dependent oligomerization of NO66 is essential for inhibition of Osx-dependent gene activation.
22750859 NO66 crystallized in space group P3(1) or P3(2), with unit-cell parameters a = 89.35, b = 89.35, c = 304.86 A, alpha = beta = 90, gamma = 120 degrees , and the crystal is likely to contain four molecules in the asymmetric unit
19927124 interactions between NO66 and Osx regulate Osx-target genes in osteoblasts by modulating histone methylation states
14742713 NO66 has functions in ribosome biogenesis and in the replication or remodeling of certain heterochromatic regions

AA Sequence

MDGLQASAGPLRRGRPKRRRKPQPHSGSVLALPLRSRKIRKQLRSVVSRMAALRTQTLPSENSEESRVES      1 - 70
TADDLGDALPGGAAVAAVPDAARREPYGHLGPAELLEASPAARSLQTPSARLVPASAPPARLVEVPAAPV     71 - 140
RVVETSALLCTAQHLAAVQSSGAPATASGPQVDNTGGEPAWDSPLRRVLAELNRIPSSRRRAARLFEWLI    141 - 210
APMPPDHFYRRLWEREAVLVRRQDHTYYQGLFSTADLDSMLRNEEVQFGQHLDAARYINGRRETLNPPGR    211 - 280
ALPAAAWSLYQAGCSLRLLCPQAFSTTVWQFLAVLQEQFGSMAGSNVYLTPPNSQGFAPHYDDIEAFVLQ    281 - 350
LEGRKLWRVYRPRVPTEELALTSSPNFSQDDLGEPVLQTVLEPGDLLYFPRGFIHQAECQDGVHSLHLTL    351 - 420
STYQRNTWGDFLEAILPLAVQAAMEENVEFRRGLPRDFMDYMGAQHSDSKDPRRTAFMEKVRVLVARLGH    421 - 490
FAPVDAVADQRAKDFIHDSLPPVLTDRERALSVYGLPIRWEAGEPVNVGAQLTTETEVHMLQDGIARLVG    491 - 560
EGGHLFLYYTVENSRVYHLEEPKCLEIYPQQADAMELLLGSYPEFVRVGDLPCDSVEDQLSLATTLYDKG    561 - 630
LLLTKMPLALN                                                               631 - 641
//

Text Mined References (18)

PMID Year Title
27309310 2016 Structure-function relationships of human JmjC oxygenases-demethylases versus hydroxylases.
26488939 2015 Expression of histone methyltransferases as novel biomarkers for renal cell tumor diagnosis and prognostication.
26327385 2015 Structure of the JmjC domain-containing protein NO66 complexed with ribosomal protein Rpl8.
23620590 2013 Structural insights into histone demethylase NO66 in interaction with osteoblast-specific transcription factor osterix and gene repression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23160351 2012 Polycomb PHF19 binds H3K36me3 and recruits PRC2 and demethylase NO66 to embryonic stem cell genes during differentiation.
23103944 2012 Oxygenase-catalyzed ribosome hydroxylation occurs in prokaryotes and humans.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22750859 2012 Purification, crystallization and preliminary crystallographic analysis of histone lysine demethylase NO66 from Homo sapiens.
19927124 2010 Regulation of the osteoblast-specific transcription factor Osterix by NO66, a Jumonji family histone demethylase.
More...